GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2026-04-24 22:31:48, GGRNA.v2 : RefSeq release 233 (Jan, 2026)

LOCUS       XM_078633157             703 bp    mRNA    linear   INV 21-JAN-2026
DEFINITION  PREDICTED: Ciona intestinalis putative E3 ubiquitin-protein ligase
            DTX3 (LOC144746179), mRNA.
ACCESSION   XM_078633157
VERSION     XM_078633157.1
DBLINK      BioProject: PRJNA1397229
KEYWORDS    RefSeq; includes ab initio.
SOURCE      Ciona intestinalis (vase tunicate)
  ORGANISM  Ciona intestinalis
            Eukaryota; Metazoa; Chordata; Tunicata; Ascidiacea; Phlebobranchia;
            Cionidae; Ciona.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_136101) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_018327825.1-RS_2026_01
            Annotation Pipeline         :: NCBI Eukaryotic Genome Annotation
                                           Pipeline (EGAP)
            Annotation Software Version :: 10.5
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 01/16/2026
            ##Genome-Annotation-Data-END##
            
            ##RefSeq-Attributes-START##
            ab initio :: 17% of CDS bases
            ##RefSeq-Attributes-END##
FEATURES             Location/Qualifiers
     source          1..703
                     /organism="Ciona intestinalis"
                     /mol_type="mRNA"
                     /db_xref="taxon:7719"
                     /chromosome="9"
                     /geo_loc_name="France:Roscoff"
                     /collection_date="2018-11-26"
     gene            1..703
                     /gene="LOC144746179"
                     /note="putative E3 ubiquitin-protein ligase DTX3; Derived
                     by automated computational analysis using gene prediction
                     method: Gnomon. Supporting evidence includes similarity
                     to: 5 Proteins, and 83% coverage of the annotated genomic
                     feature by RNAseq alignments"
                     /db_xref="GeneID:144746179"
     CDS             1..675
                     /gene="LOC144746179"
                     /codon_start=1
                     /product="putative E3 ubiquitin-protein ligase DTX3"
                     /protein_id="XP_078489283.1"
                     /db_xref="GeneID:144746179"
                     /translation="
MKLVSKSSFPLNQTSSAIAPTSKLKINFPPNFLREKDSKKEECKICLYDINSSKIKTLPCKHRFHETCVNTALKVNNLCPICKQAVGKVKGNQPHGTMIHRTQQHTHLPGYERYDAIVIDYHFPSGIQGPEHPNPGVRYTGTSRTAYLPDNYEGREVLRLLKKAFAARLIFTIGRSVTTGMDNQVTWNDIHHKTNPYGGATRFGYPDSDYLNRVKDELKAKGIQ"
ORIGIN      
atgaagcttgtttcaaagtcgagtttcccactaaaccaaacttcctcagcaattgctccaacatcaaagttaaagataaatttcccaccaaactttcttcgagagaaagacagcaaaaaagaagagtgcaaaatttgtttgtatgatattaatagttcaaaaataaagacccttccatgcaaacatagatttcatgaaacttgtgtcaacacggcattaaaggtcaacaacctttgcccaatatgtaaacaagctgtggggaaagtaaagggcaaccaaccccatggaacaatgatacatcgtacacagcaacacacccatcttcctggatatgaacgttatgatgccattgtgattgattatcattttccaagtggaatacaagggcccgaacatcccaaccctggagttcgttatactggcacaagcaggacagcttatctgccagataattatgaaggaagggaagtgttgagattgttgaagaaagcttttgccgctcgcttaattttcacaattggaagatcagtaacaactggaatggacaaccaagttacatggaatgatattcatcataaaaccaatccttatggtggtgcaactaggtttggatatccagattctgattatctaaacagagtgaaagatgaacttaaagcaaaaggaattcaataaatttgtctgcttgtgatttcttatcaaa
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]