ver.2
Home
|
Help
|
Advanced search
Previous release (v1)
2026-04-24 22:31:14, GGRNA.v2 : RefSeq release 233 (Jan, 2026)
LOCUS XM_078632233 927 bp mRNA linear INV 21-JAN-2026
DEFINITION PREDICTED: Ciona intestinalis putative oxidoreductase TM_0325
(LOC100181369), mRNA.
ACCESSION XM_078632233
VERSION XM_078632233.1
DBLINK BioProject: PRJNA1397229
KEYWORDS RefSeq.
SOURCE Ciona intestinalis (vase tunicate)
ORGANISM Ciona intestinalis
Eukaryota; Metazoa; Chordata; Tunicata; Ascidiacea; Phlebobranchia;
Cionidae; Ciona.
COMMENT MODEL REFSEQ: This record is predicted by automated computational
analysis. This record is derived from a genomic sequence
(NC_136100) annotated using gene prediction method: Gnomon.
Also see:
Documentation of NCBI's Annotation Process
##Genome-Annotation-Data-START##
Annotation Provider :: NCBI RefSeq
Annotation Status :: Full annotation
Annotation Name :: GCF_018327825.1-RS_2026_01
Annotation Pipeline :: NCBI Eukaryotic Genome Annotation
Pipeline (EGAP)
Annotation Software Version :: 10.5
Annotation Method :: Best-placed RefSeq; Gnomon;
cmsearch; tRNAscan-SE
Features Annotated :: Gene; mRNA; CDS; ncRNA
Annotation Date :: 01/16/2026
##Genome-Annotation-Data-END##
FEATURES Location/Qualifiers
source 1..927
/organism="Ciona intestinalis"
/mol_type="mRNA"
/db_xref="taxon:7719"
/chromosome="8"
/geo_loc_name="France:Roscoff"
/collection_date="2018-11-26"
gene 1..927
/gene="LOC100181369"
/note="putative oxidoreductase TM_0325; Derived by
automated computational analysis using gene prediction
method: Gnomon. Supporting evidence includes similarity
to: 52 long SRA reads, and 96% coverage of the annotated
genomic feature by RNAseq alignments, including 30 samples
with support for all annotated introns"
/db_xref="GeneID:100181369"
CDS 78..839
/gene="LOC100181369"
/codon_start=1
/product="putative oxidoreductase TM_0325"
/protein_id="XP_078488359.1"
/db_xref="GeneID:100181369"
/translation="
MGAGKRVVLVTGSSRGIGAETAKGFAKEGASLCITGLPSQKDELAEVAKVCKENGSPHVLEVAADLRKQEDMDLLMNETIKTFGQLDVLVNNAGIALFKDIEEYTSEDFDKVFSINVKAPIYLTKIARPYLSKTKGNIVNLCSVARETYARNFLVYGMSKISIAHLTKTIAAGFTKYGVRCNAVCPGVVETDIYEGAIPTDRMRKIIGYNITKLKGRLTTKSEVSDLIRFLASNKATMITGELVTIDGGRSLL"
polyA_site 927
/gene="LOC100181369"
/experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN
gagttagttgtttgagatgtgacgtatgtctcgcttgaatcgtaaacgtgctcagtaacgctgcgttgtcattcaatatgggtgctggtaaacgagttgttcttgtaacgggtagttcgaggggaattggtgcggaaactgctaaaggatttgcaaaagaaggagcctcattgtgcatcactgggttaccatcccagaaagatgaattggcagaagttgcgaaagtttgcaaagaaaatggatctccgcatgtattggaagtagcagctgatctaagaaaacaagaagatatggatttgttgatgaatgaaacgatcaagacgtttggacaacttgatgtcttggtcaacaacgcaggaatcgcattgttcaaagatatagaagagtacaccagtgaagatttcgataaagtgtttagcattaatgttaaagcgccgatctatctaaccaagattgcaaggccatatctcagcaaaactaaaggaaacatcgtcaacttgtgcagtgttgcaagagagacatacgcccgcaatttccttgtgtatggaatgtcaaaaatatcaattgcccatctaactaaaaccattgcggcaggttttaccaagtacggagtacgctgtaacgccgtgtgtccgggcgttgtagaaactgatatatacgaaggcgcaatacctacagatcgcatgcgtaagatcattggctacaacataactaaactgaagggtcgactgacaactaaaagtgaagtttcagacctcataaggttccttgcttcaaataaagcgaccatgatcactggagagttggttactattgacggtggacgatctttactttaatattcaatatatactgactcaatatttatagtgattaaataaatttgtattttaattcaatatccgcattaaaatattgcggaaaatt
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]