ver.2
Home
|
Help
|
Advanced search
Previous release (v1)
2026-04-24 20:54:30, GGRNA.v2 : RefSeq release 233 (Jan, 2026)
LOCUS XM_078630936 526 bp mRNA linear INV 21-JAN-2026 DEFINITION PREDICTED: Ciona intestinalis homeobox protein BarH-like 1 (LOC144745134), mRNA. ACCESSION XM_078630936 VERSION XM_078630936.1 DBLINK BioProject: PRJNA1397229 KEYWORDS RefSeq. SOURCE Ciona intestinalis (vase tunicate) ORGANISM Ciona intestinalis Eukaryota; Metazoa; Chordata; Tunicata; Ascidiacea; Phlebobranchia; Cionidae; Ciona. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_136099) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_018327825.1-RS_2026_01 Annotation Pipeline :: NCBI Eukaryotic Genome Annotation Pipeline (EGAP) Annotation Software Version :: 10.5 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 01/16/2026 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..526 /organism="Ciona intestinalis" /mol_type="mRNA" /db_xref="taxon:7719" /chromosome="7" /geo_loc_name="France:Roscoff" /collection_date="2018-11-26" gene 1..526 /gene="LOC144745134" /note="homeobox protein BarH-like 1; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 long SRA read, 2 Proteins, and 90% coverage of the annotated genomic feature by RNAseq alignments, including 12 samples with support for all annotated introns" /db_xref="GeneID:144745134" CDS 3..470 /gene="LOC144745134" /codon_start=1 /product="homeobox protein BarH-like 1" /protein_id="XP_078487062.1" /db_xref="GeneID:144745134" /translation="
MSLARFNHQTYDNIPGLPVYLRREASSPSDNSNNGDTKSKKCRRSRTVFTELQLMGLERKFEQKKYLSTPDRMELAETLGLTQLQVKTWYQNRRMKWKKQSQLNGSIVDSQLKPKGRPRKSPEPEPKLRQKVSEKIVSNMNSSLMQSPDHVINEN"
ORIGIN
cgatgtccctagcgaggttcaaccaccaaacgtacgataatataccggggttgccggtttatcttcggagagaagcgtcgagtccaagcgataactcgaataatggggacacgaagtccaagaaatgtcgtcgtagcagaaccgtgttcaccgagttacaactaatggggttggaacggaagtttgaacagaagaaatatctgtctacaccagatcgtatggaactcgcagaaacactgggccttactcaactacaagtaaaaacttggtatcagaacaggagaatgaagtggaaaaaacagagccaactaaacggatccattgttgattcacaactgaagccgaagggtcggcctcggaaatcccctgaaccagaaccaaaactacgacaaaaagttagcgagaaaatagtctcaaacatgaacagcagcctcatgcaatctcctgatcatgtgattaatgaaaattaacggaaaaatttaagaatctacgaagaaaatgaaatgccaagtgatatacaatgtcg
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]