LOCUS       XM_078628954             905 bp    mRNA    linear   INV 21-JAN-2026
DEFINITION  PREDICTED: Ciona intestinalis claudin-16-like (LOC100186332), mRNA.
ACCESSION   XM_078628954
VERSION     XM_078628954.1
DBLINK      BioProject: PRJNA1397229
KEYWORDS    RefSeq; corrected model.
SOURCE      Ciona intestinalis (vase tunicate)
  ORGANISM  Ciona intestinalis
            Eukaryota; Metazoa; Chordata; Tunicata; Ascidiacea; Phlebobranchia;
            Cionidae; Ciona.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_136097) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_018327825.1-RS_2026_01
            Annotation Pipeline         :: NCBI Eukaryotic Genome Annotation
                                           Pipeline (EGAP)
            Annotation Software Version :: 10.5
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 01/16/2026
            ##Genome-Annotation-Data-END##
            
            ##RefSeq-Attributes-START##
            internal stop codons :: corrected 1 genomic stop codon
            ##RefSeq-Attributes-END##
FEATURES             Location/Qualifiers
     source          1..905
                     /organism="Ciona intestinalis"
                     /mol_type="mRNA"
                     /db_xref="taxon:7719"
                     /chromosome="5"
                     /geo_loc_name="France:Roscoff"
                     /collection_date="2018-11-26"
     gene            1..905
                     /gene="LOC100186332"
                     /note="claudin-16-like; Derived by automated computational
                     analysis using gene prediction method: Gnomon. Supporting
                     evidence includes similarity to: 8 long SRA reads, 2
                     Proteins, and 94% coverage of the annotated genomic
                     feature by RNAseq alignments, including 32 samples with
                     support for all annotated introns"
                     /db_xref="GeneID:100186332"
     CDS             1..819
                     /gene="LOC100186332"
                     /note="The sequence of the model RefSeq protein was
                     modified relative to its source genomic sequence to
                     represent the inferred CDS: substituted 1 base at 1
                     genomic stop codon"
                     /codon_start=1
                     /transl_except=(pos:376..378,aa:OTHER)
                     /product="LOW QUALITY PROTEIN: claudin-16-like"
                     /protein_id="XP_078485080.1"
                     /db_xref="GeneID:100186332"
                     /translation="

MADCATDSVSSVIAPLCKFAGFIFGLTAASCVVFVTVTPCWYVIYAEASISPYENCYGLWKFCSSTGLCGKWLSGSLLGSHGAQRTVCRGLMITACLLSGFALILNVMGMRCILLFRLLPRTKEKXTRRAAVVWIVAGTFVLISSTWYGLEVMYSVWDEGKASELSDGIFVGWGATAFAYAAAGLLWIGATLSRSERKEAEKRRDSILSTVAAAYAASRSGSGASTTCCCYLAPRLPGHECGHHSNTADDKIRTLEPITECRVTSHARTTYM"

     polyA_site      905
                     /gene="LOC100186332"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      

atggcagattgcgctacagacagtgtctcgtctgtgatagcgccgttatgcaagtttgcaggttttatttttggactgacagcagctagttgtgtagttttcgtgaccgtaactccttgttggtacgtcatctatgctgaagcatcgatctcgccgtacgagaattgttatggtctttggaaattttgcagctctactggtttatgtggaaaatggctgtctggttccctactcggctcacatggagcgcagcggactgtatgccgaggtctcatgataactgcttgtctactgagtggatttgctctgattctaaacgttatgggaatgcgatgcatcctgctttttcggcttctcccacggacaaaagaaaagtaaactcgacgcgcagctgttgtatggatagtagcaggtaccttcgtgttaatatcaagcacctggtatggtctggaggtaatgtactcagtatgggacgaaggtaaagcttccgaactttcagacggtatatttgttggttggggagcgactgcgtttgcttatgcagctgccggactactgtggataggtgcaactctatcgaggagtgaaaggaaagaagcagaaaaacgtcgagattcgattctgtcaacagtagccgcggcgtacgctgcaagtcgcagtggttcaggggcaagcacgacttgttgctgctacttggcgcctcggctgcccggccacgagtgtgggcaccatagcaacacagcggacgacaagatacgaactctggaaccaatcactgaatgtcgggtgacatcgcacgcaaggacaacttacatgtaatttatagagacttcgagaaaattagcaggaggcaagattcttaaccgcttattttgaaagctctaataaaactgttcaacaaagca

//