2025-09-18 22:44:38, GGRNA.v2 : RefSeq release 231 (Jul, 2025)
LOCUS XM_026839514 2230 bp mRNA linear INV 22-OCT-2018 DEFINITION PREDICTED: Ciona intestinalis cGMP-dependent protein kinase 2-like (LOC113474046), mRNA. ACCESSION XM_026839514 VERSION XM_026839514.1 DBLINK BioProject: PRJNA187185 KEYWORDS RefSeq. SOURCE Ciona intestinalis (vase tunicate) ORGANISM Ciona intestinalis Eukaryota; Metazoa; Chordata; Tunicata; Ascidiacea; Phlebobranchia; Cionidae; Ciona. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NW_004190678.1) annotated using gene prediction method: Gnomon, supported by EST evidence. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI Annotation Status :: Full annotation Annotation Name :: Ciona intestinalis Annotation Release 104 Annotation Version :: 104 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 8.1 Annotation Method :: Best-placed RefSeq; Gnomon Features Annotated :: Gene; mRNA; CDS; ncRNA ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..2230 /organism="Ciona intestinalis" /mol_type="mRNA" /db_xref="taxon:7719" /chromosome="Unknown" gene 1..2230 /gene="LOC113474046" /note="Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 5 ESTs, 2 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 2 samples with support for all annotated introns" /db_xref="GeneID:113474046" CDS 23..1075 /gene="LOC113474046" /codon_start=1 /product="cGMP-dependent protein kinase 2-like" /protein_id="XP_026695315.1" /db_xref="GeneID:113474046" /translation="
MRKLNKRGYDVTHRKHFASVVAELSGKGLQDFHVVATIGNGAFGLVDLVTLATNQNCAFAVKKMSNQEIVSNDQQNHVTQEKEIQFVTSQECPFIASLYTSFKDKRYVYFVMEYCAGGELFKLMTSAKSFDRKAARFYAGCVIEALSYLHSGNIVYRDLKPENLVLDGRGYCKLTDFGFAKKLSKRSGLKTFTFCGTPECMAPEAILYKGHSFPVDLWSLGVFIYEIVVGKAPFRNRNKDELGQSILRGVEPKLIAAKEAKRIDDVTVAIVRELCQMRPEDRLGAGRMGIHDVTKHCWFDGFDWELLRQRKMESPWKPQLNSATDVRYFDVYNKTPASVSGEFPGWDETF"
misc_feature 134..940 /gene="LOC113474046" /note="The protein kinase superfamily is mainly composed of the catalytic domains of serine/threonine-specific and tyrosine-specific protein kinases. It also includes RIO kinases, which are atypical serine protein kinases, aminoglycoside phosphotransferases; Region: Protein Kinases, catalytic domain; cl21453" /db_xref="CDD:473864" misc_feature order(134..145,152..154,158..160,200..202,206..208, 308..310,356..367,494..496,506..511,515..517,545..550) /gene="LOC113474046" /note="ATP binding site [chemical binding]; other site" /db_xref="CDD:270724" misc_feature 920..1072 /gene="LOC113474046" /note="Extension to Ser/Thr-type protein kinases; Region: S_TK_X; smart00133" /db_xref="CDD:214529" ORIGIN
cgaaggaaattctccagctttgatgcggaaactcaacaaacgtggttatgacgtcacacacagaaaacatttcgcttcggttgttgccgagttatcgggcaaagggttgcaagatttccacgtggtggcgaccatcggcaacggagctttcggattggttgatcttgtcaccctggcgaccaatcagaactgcgcattcgctgttaagaaaatgtcaaatcaagaaatcgtttcaaacgaccagcaaaaccacgtgacacaagagaaagaaatacagtttgtgacgtcacaagagtgtccatttattgcgtcactatacacatcgtttaaagacaaaaggtacgtttatttcgtcatggaatattgcgccggcggggaattatttaaattgatgacgtcagcaaaatcattcgaccggaaagcagcgagattctacgcaggttgcgtcatagaagctttatcgtatttacattcaggaaacatcgtgtatcgcgatttgaagccggagaacctggttcttgatggaagaggttattgtaaacttaccgactttggattcgcaaagaaattatcgaaaagatctggattgaaaactttcactttctgtgggactcccgaatgcatggcccctgaagctatactgtataaaggccattcgtttccggttgatctttggtcgctaggtgtcttcatttacgagatcgttgtagggaaagcccccttccgaaaccgcaacaaggacgagcttggtcaatccatcctgcgcggtgtcgagccgaagttaattgcggcgaaagaagccaaacgtattgatgacgtcacagtggctattgttcgtgaattatgtcaaatgcgacctgaagatcgacttggtgctggaagaatgggcattcatgacgtcacaaagcattgttggttcgatggcttcgattgggaattattacgtcagaggaaaatggagtcgccttggaaacctcaactcaacagcgccaccgacgtccgatattttgatgtttataataaaactcccgcgagtgtatcgggggaattccctgggtgggatgaaactttttaaagttcaaaatatttgatttgtaaactttatgttctagttatacgtgggtagttgtgttgttactgtgctgtgtatgtatcttcatttattcttcacaaaataaagacggaattttaactcacagccgctgagtagtttggataatttcagctattgttttacaacaaaatatcatattaacaaaatattagtatcttgatgaaagtcacaaacgcccacaatagtggaagcatctggtcccgaacccatgcactctgtgatatggtagcgagagttttaaccgctaagccatgtgtccaataaaaaggactagagttaaaatgtttgtaaaagatattttgtcgcaaaatccgaaccccgaggttaagattgtccattgtaagaatttgaaaagtatatcctgggcaacacatgaataactcgatgacgttgagagtaaatgtaaaagtggttgctctgtggtttgcgcctcgatgtaatacctcactcgtttagaatagaaatgatttcaaaagtaaattcacgctggaaatagagtatcaaaatcgcgaatcatcgtgaacttcgtttgttacgtcgcaatgctgatctgaagctgattggtcagattgctcacgtgaccgacgactcgcaccagctgataacgccttgattgctccgcgcataaaacgcctcttctacaaagctaccacgtttcagtttagatgaaggttccagaccaggttacaagttaaaaggttttaacaagtttacttgcaagacttgaaagtcacgtgatcggcttgtcgaatatattcgagcgtctccaatgtattttcgctgctgaattgtgacgtttgattcatcagttgtgacgtattatgctgacatcgtgacgtcactatggggttacaattttgcggtgctttataaacaactcgctgtagcgaaacacagggaaggagctcggttttgtaatattgtgacgtcaacaataaccttgaacgggttatcttgcgccccctggtgtgaagaagatgtcgatgggttccggatgtttcgggacgggaagtgacgtcagcagaacattctttcttttgctgcgtcatatccttactataaacgaaacaaaactttgacccatttactattacaaattttgtttaacttttcggt
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]