ver.2
Home
|
Help
|
Advanced search
Previous release (v1)
2025-11-01 19:33:17, GGRNA.v2 : RefSeq release 232 (Sep, 2025)
LOCUS XM_026839514 2230 bp mRNA linear INV 22-OCT-2018
DEFINITION PREDICTED: Ciona intestinalis cGMP-dependent protein kinase 2-like
(LOC113474046), mRNA.
ACCESSION XM_026839514
VERSION XM_026839514.1
DBLINK BioProject: PRJNA187185
KEYWORDS RefSeq.
SOURCE Ciona intestinalis (vase tunicate)
ORGANISM Ciona intestinalis
Eukaryota; Metazoa; Chordata; Tunicata; Ascidiacea; Phlebobranchia;
Cionidae; Ciona.
COMMENT MODEL REFSEQ: This record is predicted by automated computational
analysis. This record is derived from a genomic sequence
(NW_004190678.1) annotated using gene prediction method: Gnomon,
supported by EST evidence.
Also see:
Documentation of NCBI's Annotation Process
##Genome-Annotation-Data-START##
Annotation Provider :: NCBI
Annotation Status :: Full annotation
Annotation Name :: Ciona intestinalis Annotation
Release 104
Annotation Version :: 104
Annotation Pipeline :: NCBI eukaryotic genome annotation
pipeline
Annotation Software Version :: 8.1
Annotation Method :: Best-placed RefSeq; Gnomon
Features Annotated :: Gene; mRNA; CDS; ncRNA
##Genome-Annotation-Data-END##
FEATURES Location/Qualifiers
source 1..2230
/organism="Ciona intestinalis"
/mol_type="mRNA"
/db_xref="taxon:7719"
/chromosome="Unknown"
gene 1..2230
/gene="LOC113474046"
/note="Derived by automated computational analysis using
gene prediction method: Gnomon. Supporting evidence
includes similarity to: 5 ESTs, 2 Proteins, and 100%
coverage of the annotated genomic feature by RNAseq
alignments, including 2 samples with support for all
annotated introns"
/db_xref="GeneID:113474046"
CDS 23..1075
/gene="LOC113474046"
/codon_start=1
/product="cGMP-dependent protein kinase 2-like"
/protein_id="XP_026695315.1"
/db_xref="GeneID:113474046"
/translation="
MRKLNKRGYDVTHRKHFASVVAELSGKGLQDFHVVATIGNGAFGLVDLVTLATNQNCAFAVKKMSNQEIVSNDQQNHVTQEKEIQFVTSQECPFIASLYTSFKDKRYVYFVMEYCAGGELFKLMTSAKSFDRKAARFYAGCVIEALSYLHSGNIVYRDLKPENLVLDGRGYCKLTDFGFAKKLSKRSGLKTFTFCGTPECMAPEAILYKGHSFPVDLWSLGVFIYEIVVGKAPFRNRNKDELGQSILRGVEPKLIAAKEAKRIDDVTVAIVRELCQMRPEDRLGAGRMGIHDVTKHCWFDGFDWELLRQRKMESPWKPQLNSATDVRYFDVYNKTPASVSGEFPGWDETF"
misc_feature 134..940
/gene="LOC113474046"
/note="The protein kinase superfamily is mainly composed
of the catalytic domains of serine/threonine-specific and
tyrosine-specific protein kinases. It also includes RIO
kinases, which are atypical serine protein kinases,
aminoglycoside phosphotransferases; Region: Protein
Kinases, catalytic domain; cl21453"
/db_xref="CDD:473864"
misc_feature order(134..145,152..154,158..160,200..202,206..208,
308..310,356..367,494..496,506..511,515..517,545..550)
/gene="LOC113474046"
/note="ATP binding site [chemical binding]; other site"
/db_xref="CDD:270724"
misc_feature 920..1072
/gene="LOC113474046"
/note="Extension to Ser/Thr-type protein kinases; Region:
S_TK_X; smart00133"
/db_xref="CDD:214529"
ORIGIN
cgaaggaaattctccagctttgatgcggaaactcaacaaacgtggttatgacgtcacacacagaaaacatttcgcttcggttgttgccgagttatcgggcaaagggttgcaagatttccacgtggtggcgaccatcggcaacggagctttcggattggttgatcttgtcaccctggcgaccaatcagaactgcgcattcgctgttaagaaaatgtcaaatcaagaaatcgtttcaaacgaccagcaaaaccacgtgacacaagagaaagaaatacagtttgtgacgtcacaagagtgtccatttattgcgtcactatacacatcgtttaaagacaaaaggtacgtttatttcgtcatggaatattgcgccggcggggaattatttaaattgatgacgtcagcaaaatcattcgaccggaaagcagcgagattctacgcaggttgcgtcatagaagctttatcgtatttacattcaggaaacatcgtgtatcgcgatttgaagccggagaacctggttcttgatggaagaggttattgtaaacttaccgactttggattcgcaaagaaattatcgaaaagatctggattgaaaactttcactttctgtgggactcccgaatgcatggcccctgaagctatactgtataaaggccattcgtttccggttgatctttggtcgctaggtgtcttcatttacgagatcgttgtagggaaagcccccttccgaaaccgcaacaaggacgagcttggtcaatccatcctgcgcggtgtcgagccgaagttaattgcggcgaaagaagccaaacgtattgatgacgtcacagtggctattgttcgtgaattatgtcaaatgcgacctgaagatcgacttggtgctggaagaatgggcattcatgacgtcacaaagcattgttggttcgatggcttcgattgggaattattacgtcagaggaaaatggagtcgccttggaaacctcaactcaacagcgccaccgacgtccgatattttgatgtttataataaaactcccgcgagtgtatcgggggaattccctgggtgggatgaaactttttaaagttcaaaatatttgatttgtaaactttatgttctagttatacgtgggtagttgtgttgttactgtgctgtgtatgtatcttcatttattcttcacaaaataaagacggaattttaactcacagccgctgagtagtttggataatttcagctattgttttacaacaaaatatcatattaacaaaatattagtatcttgatgaaagtcacaaacgcccacaatagtggaagcatctggtcccgaacccatgcactctgtgatatggtagcgagagttttaaccgctaagccatgtgtccaataaaaaggactagagttaaaatgtttgtaaaagatattttgtcgcaaaatccgaaccccgaggttaagattgtccattgtaagaatttgaaaagtatatcctgggcaacacatgaataactcgatgacgttgagagtaaatgtaaaagtggttgctctgtggtttgcgcctcgatgtaatacctcactcgtttagaatagaaatgatttcaaaagtaaattcacgctggaaatagagtatcaaaatcgcgaatcatcgtgaacttcgtttgttacgtcgcaatgctgatctgaagctgattggtcagattgctcacgtgaccgacgactcgcaccagctgataacgccttgattgctccgcgcataaaacgcctcttctacaaagctaccacgtttcagtttagatgaaggttccagaccaggttacaagttaaaaggttttaacaagtttacttgcaagacttgaaagtcacgtgatcggcttgtcgaatatattcgagcgtctccaatgtattttcgctgctgaattgtgacgtttgattcatcagttgtgacgtattatgctgacatcgtgacgtcactatggggttacaattttgcggtgctttataaacaactcgctgtagcgaaacacagggaaggagctcggttttgtaatattgtgacgtcaacaataaccttgaacgggttatcttgcgccccctggtgtgaagaagatgtcgatgggttccggatgtttcgggacgggaagtgacgtcagcagaacattctttcttttgctgcgtcatatccttactataaacgaaacaaaactttgacccatttactattacaaattttgtttaacttttcggt
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]