2024-05-05 21:50:56, GGRNA.v2 : RefSeq release 222 (Jan, 2024)
LOCUS XM_026835376 594 bp mRNA linear INV 22-OCT-2018 DEFINITION PREDICTED: Ciona intestinalis uncharacterized protein C1orf189 homolog (LOC100177459), mRNA. ACCESSION XM_026835376 VERSION XM_026835376.1 DBLINK BioProject: PRJNA187185 KEYWORDS RefSeq. SOURCE Ciona intestinalis (vase tunicate) ORGANISM Ciona intestinalis Eukaryota; Metazoa; Chordata; Tunicata; Ascidiacea; Phlebobranchia; Cionidae; Ciona. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_020173.2) annotated using gene prediction method: Gnomon, supported by EST evidence. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI Annotation Status :: Full annotation Annotation Name :: Ciona intestinalis Annotation Release 104 Annotation Version :: 104 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 8.1 Annotation Method :: Best-placed RefSeq; Gnomon Features Annotated :: Gene; mRNA; CDS; ncRNA ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..594 /organism="Ciona intestinalis" /mol_type="mRNA" /db_xref="taxon:7719" /chromosome="8" gene 1..594 /gene="LOC100177459" /note="Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 12 ESTs, 1 Protein, and 100% coverage of the annotated genomic feature by RNAseq alignments" /db_xref="GeneID:100177459" CDS 85..447 /gene="LOC100177459" /codon_start=1 /product="uncharacterized protein C1orf189 homolog" /protein_id="XP_026691177.1" /db_xref="GeneID:100177459" /translation="
MSMNMSLRFEVANRGGSLINSLKVEKERIMKDELMAERILQVTTEKNDNLKAGWAEGLEEASQTQRYRLNKEEIKHELSYANKAVVAVRRAALRELLEREHDMYEQELHKIGKAFYIKRT"
misc_feature 208..441 /gene="LOC100177459" /note="Domain of unknown function (DUF4558); Region: DUF4558; pfam15104" /db_xref="CDD:434461" ORIGIN
atttaatttgtttcacagcatttttataaaaacaaagaggtttatattaaaactacagttatttggaagatctgaaatttcaagatgagtatgaacatgtctctccgatttgaggtagctaatagaggtggaagcttgataaattcactgaaagtggaaaaagaaagaatcatgaaagatgagttaatggctgagaggatcttgcaagtaacgactgaaaagaatgataaccttaaagctggttgggcagaaggtcttgaagaggccagccagacgcaaagatacagactgaataaagaagaaatcaagcatgaactgtcatatgccaacaaagcggttgttgctgtaagaagagctgcacttagagaacttcttgaaagagagcatgacatgtatgagcaggagctacataaaattggaaaagcattctacatcaaacgcacttaaaaacatttaacgtacttgttttgcatgttgcacaagtgttttaattaatataaattcgccatatattattttatcatttgcttttgcaattacacatagaagtatatttttatgaaatatttttaatttttttgcaaaatttttaga
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]