GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2024-05-06 00:21:27, GGRNA.v2 : RefSeq release 222 (Jan, 2024)

LOCUS       XM_009862996            1322 bp    mRNA    linear   INV 22-OCT-2018
DEFINITION  PREDICTED: Ciona intestinalis ADP-ribosylation factor-like protein
            6 (LOC100182512), mRNA.
ACCESSION   XM_009862996
VERSION     XM_009862996.3
DBLINK      BioProject: PRJNA187185
KEYWORDS    RefSeq; corrected model.
SOURCE      Ciona intestinalis (vase tunicate)
  ORGANISM  Ciona intestinalis
            Eukaryota; Metazoa; Chordata; Tunicata; Ascidiacea; Phlebobranchia;
            Cionidae; Ciona.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NW_004190397.2) annotated using gene prediction method: Gnomon,
            supported by EST evidence.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Oct 22, 2018 this sequence version replaced XM_009862996.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Full annotation
            Annotation Name             :: Ciona intestinalis Annotation
                                           Release 104
            Annotation Version          :: 104
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 8.1
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
            
            ##RefSeq-Attributes-START##
            frameshifts :: corrected 1 indel
            ##RefSeq-Attributes-END##
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-219               EAAA01003465.1     20411-20629
            220-383             EAAA01003465.1     20983-21146
            384-424             EAAA01003465.1     21574-21614
            425-513             EAAA01003465.1     21616-21704
            514-1322            EAAA01003465.1     21899-22707
FEATURES             Location/Qualifiers
     source          1..1322
                     /organism="Ciona intestinalis"
                     /mol_type="mRNA"
                     /db_xref="taxon:7719"
                     /chromosome="Unknown"
     gene            1..1322
                     /gene="LOC100182512"
                     /note="The sequence of the model RefSeq transcript was
                     modified relative to its source genomic sequence to
                     represent the inferred CDS: deleted 1 base in 1 codon;
                     Derived by automated computational analysis using gene
                     prediction method: Gnomon. Supporting evidence includes
                     similarity to: 7 ESTs, 20 Proteins, and 100% coverage of
                     the annotated genomic feature by RNAseq alignments,
                     including 192 samples with support for all annotated
                     introns"
                     /db_xref="GeneID:100182512"
     CDS             35..592
                     /gene="LOC100182512"
                     /note="The sequence of the model RefSeq protein was
                     modified relative to its source genomic sequence to
                     represent the inferred CDS: deleted 1 base in 1 codon"
                     /codon_start=1
                     /product="LOW QUALITY PROTEIN: ADP-ribosylation
                     factor-like protein 6"
                     /protein_id="XP_009861298.1"
                     /db_xref="GeneID:100182512"
                     /translation="
MGIMNKLFGWLKGKKKEANVLCVGLDNSGKTTIINYLKPNDAQQVDIVPTVGFNVEKVTMTNLSFTVFDMSGQGRYRVLWSHYYKETQGVIFVVDSADKLRMAVAKDELDQLLKHQTIMNKRIPILFFANKMDVQNSLSAVKCSQLLGLENIKEKPWHICASNAKTGEGLSDGMHWLSDQLQTVK"
     misc_feature    89..574
                     /gene="LOC100182512"
                     /note="Arf-like 6 (Arl6) GTPase; Region: Arl6; cd04157"
                     /db_xref="CDD:206722"
     misc_feature    104..127
                     /gene="LOC100182512"
                     /note="G1 box; other site"
                     /db_xref="CDD:206722"
     misc_feature    order(110..130,179..184,248..250,422..427,431..433,
                     521..529)
                     /gene="LOC100182512"
                     /note="GTP/Mg2+ binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:206722"
     misc_feature    order(110..115,125..127,137..139,179..202,266..268,
                     281..283)
                     /gene="LOC100182512"
                     /note="putative GAP interaction site [polypeptide
                     binding]; other site"
                     /db_xref="CDD:206722"
     misc_feature    order(140..154,161..193)
                     /gene="LOC100182512"
                     /note="Switch I region; other site"
                     /db_xref="CDD:206722"
     misc_feature    order(182..196,209..211,239..241,251..253,269..271,
                     275..283)
                     /gene="LOC100182512"
                     /note="putative GEF interaction site [polypeptide
                     binding]; other site"
                     /db_xref="CDD:206722"
     misc_feature    182..184
                     /gene="LOC100182512"
                     /note="G2 box; other site"
                     /db_xref="CDD:206722"
     misc_feature    order(185..208,236..238,269..271,278..283)
                     /gene="LOC100182512"
                     /note="putative effector interaction site [active]"
                     /db_xref="CDD:206722"
     misc_feature    order(194..214,221..238)
                     /gene="LOC100182512"
                     /note="interswitch region [active]"
                     /db_xref="CDD:206722"
     misc_feature    239..292
                     /gene="LOC100182512"
                     /note="Switch II region; other site"
                     /db_xref="CDD:206722"
     misc_feature    239..250
                     /gene="LOC100182512"
                     /note="G3 box; other site"
                     /db_xref="CDD:206722"
     misc_feature    422..433
                     /gene="LOC100182512"
                     /note="G4 box; other site"
                     /db_xref="CDD:206722"
     misc_feature    521..529
                     /gene="LOC100182512"
                     /note="G5 box; other site"
                     /db_xref="CDD:206722"
ORIGIN      
tttttaggctttaattaagttaaataactaaaaaatgggtataatgaacaagttatttggctggcttaaaggcaaaaagaaagaggccaatgttttatgtgtaggtttagacaacagtgggaaaactacaatcattaattacctgaaaccaaacgacgcacaacaagtagatattgtacctactgtaggattcaatgtagaaaaagttacaatgaccaatctctcattcactgtgtttgatatgagtgggcaaggacgttacagagttctctggtcacattactacaaggaaacacagggcgttatatttgtagtggacagtgcagataaactgagaatggctgtagctaaagatgaattagaccagcttttgaagcaccaaacaattatgaacaaaagaattcccattttatttttcgctaacaaaatggacgttcagaattctctgtccgcagttaaatgttcgcagttacttggtttggaaaatattaaagaaaaaccatggcatatatgtgctagcaatgctaagacaggagaaggcttaagcgacggaatgcactggttatctgaccaacttcaaactgttaagtgatacgccatgtttggaacttgattgaacttaagtgtttcatatactataggaccagtggcgttgattttataaaaaaaagttgactttataaattatcaaaaagggttaaatgttatgtatgtaagactaagagtacatttgcatttattttaagtgcttttaaaattggaaatttagggtaagcctacataccctgcaacatatttatcgtattcgctaatacaaagccctaagcttggcattttattttattcgagttgaaacatattataatgtttactttactgaagggtatataaacacgtgtttataaaaaattcatatatattattttttataagtttttcagtatgctatgtttattttactaatgggtaccaacttaaaatactattgttttcatagcaaaaattcatatatattttacatttacattaagtctgtttttttttactttttaagaccccgcattgctaatggtgcaataacactgtgaaaaatacattgtggtcattttaaagacattttttaggatgtattaccccctaacatatgttatatataaatataggcttgcctattcataatatctcaattttgtgtcaacccttaactatttcatgcgctatatggtaaaaatgccagtagtatattgttttgtgccatattctgcttttaaatatgttatcgttgtgaaaaaataaatttgaaaggaaaacttacaatttaa
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]