GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2024-05-05 18:41:02, GGRNA.v2 : RefSeq release 222 (Jan, 2024)

LOCUS       XM_002131669             484 bp    mRNA    linear   INV 22-OCT-2018
DEFINITION  PREDICTED: Ciona intestinalis 60S ribosomal protein L35
            (LOC100179536), mRNA.
ACCESSION   XM_002131669
VERSION     XM_002131669.5
DBLINK      BioProject: PRJNA187185
KEYWORDS    RefSeq.
SOURCE      Ciona intestinalis (vase tunicate)
  ORGANISM  Ciona intestinalis
            Eukaryota; Metazoa; Chordata; Tunicata; Ascidiacea; Phlebobranchia;
            Cionidae; Ciona.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_020174.2) annotated using gene prediction method: Gnomon,
            supported by mRNA and EST evidence.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Oct 22, 2018 this sequence version replaced XM_002131669.4.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Full annotation
            Annotation Name             :: Ciona intestinalis Annotation
                                           Release 104
            Annotation Version          :: 104
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 8.1
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..484
                     /organism="Ciona intestinalis"
                     /mol_type="mRNA"
                     /db_xref="taxon:7719"
                     /chromosome="9"
     gene            1..484
                     /gene="LOC100179536"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 2 mRNAs, 672 ESTs, 29 Proteins,
                     and 100% coverage of the annotated genomic feature by
                     RNAseq alignments, including 228 samples with support for
                     all annotated introns"
                     /db_xref="GeneID:100179536"
     CDS             86..457
                     /gene="LOC100179536"
                     /codon_start=1
                     /product="60S ribosomal protein L35"
                     /protein_id="XP_002131705.1"
                     /db_xref="GeneID:100179536"
                     /translation="
MARIKAKELRGKSKDELLKQLNDFKQELSTLRVAKVTGGAASKLSKICLVRKSIARVLTVINQTQKDNLRKLFKGKKHKPKDLRPKKTRALRRRLNKHEESLKSVKALKKARLYPQRQFAIKA"
     misc_feature    104..274
                     /gene="LOC100179536"
                     /note="Ribosomal L29 protein; Region: Ribosomal_L29;
                     pfam00831"
                     /db_xref="CDD:425893"
     misc_feature    order(104..106,113..115,218..220,248..253,257..262,
                     272..274)
                     /gene="LOC100179536"
                     /note="23S rRNA interface [nucleotide binding]; other
                     site"
                     /db_xref="CDD:238243"
     misc_feature    order(104..112,116..118,128..133,137..142,149..154,
                     161..166,173..175,182..187,212..214,221..223,233..235,
                     242..247,254..259,266..268)
                     /gene="LOC100179536"
                     /note="putative translocon interaction site [active]"
                     /db_xref="CDD:238243"
     misc_feature    order(152..154,164..166,173..175,185..187,233..235)
                     /gene="LOC100179536"
                     /note="signal recognition particle (SRP54) interaction
                     site [active]"
                     /db_xref="CDD:238243"
     misc_feature    order(170..172,179..184)
                     /gene="LOC100179536"
                     /note="L23 interface [polypeptide binding]; other site"
                     /db_xref="CDD:238243"
     misc_feature    191..196
                     /gene="LOC100179536"
                     /note="trigger factor interaction site [active]"
                     /db_xref="CDD:238243"
ORIGIN      
tttataaaaaggaaacactgttgcggattcattggtttgttggcgaggtttggaaccttggctccttttgaattgaagtcttgaaatggctcgtatcaaagccaaggaactgcgtggaaagtcgaaggacgagctgcttaagcagctaaacgacttcaagcaggaattatctaccctgcgggttgcgaaagtgaccggaggagccgcatcaaagctctcaaaaatatgcttggtccgcaaaagcatcgctcgtgtcctcacggtcattaaccagactcaaaaggataacttgaggaaattgtttaagggaaagaaacataagcctaaggatttacgaccgaaaaagaccagagccctgcgtcgtcgtttaaacaaacatgaagaaagtttaaaatccgtaaaagctttgaaaaaagcaagactctacccacagcgacagtttgcaatcaaggcataaggttctaataaaccatttcgggatata
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]