LOCUS       XM_002129961             751 bp    mRNA    linear   INV 21-JAN-2026
DEFINITION  PREDICTED: Ciona intestinalis claudin-7 (LOC100183075), mRNA.
ACCESSION   XM_002129961
VERSION     XM_002129961.4
DBLINK      BioProject: PRJNA1397229
KEYWORDS    RefSeq.
SOURCE      Ciona intestinalis (vase tunicate)
  ORGANISM  Ciona intestinalis
            Eukaryota; Metazoa; Chordata; Tunicata; Ascidiacea; Phlebobranchia;
            Cionidae; Ciona.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_136103) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Jan 21, 2026 this sequence version replaced XM_002129961.3.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_018327825.1-RS_2026_01
            Annotation Pipeline         :: NCBI Eukaryotic Genome Annotation
                                           Pipeline (EGAP)
            Annotation Software Version :: 10.5
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 01/16/2026
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..751
                     /organism="Ciona intestinalis"
                     /mol_type="mRNA"
                     /db_xref="taxon:7719"
                     /chromosome="11"
                     /geo_loc_name="France:Roscoff"
                     /collection_date="2018-11-26"
     gene            1..751
                     /gene="LOC100183075"
                     /note="claudin-7; Derived by automated computational
                     analysis using gene prediction method: Gnomon. Supporting
                     evidence includes similarity to: 2 long SRA reads, 9
                     Proteins, and 100% coverage of the annotated genomic
                     feature by RNAseq alignments, including 52 samples with
                     support for all annotated introns"
                     /db_xref="GeneID:100183075"
     CDS             69..716
                     /gene="LOC100183075"
                     /codon_start=1
                     /product="claudin-7"
                     /protein_id="XP_002129997.2"
                     /db_xref="GeneID:100183075"
                     /translation="

MVNGGLQVGGFVLGLIGWILGIVTCTLPDWRKNDLQGEVIESVIRTTGLWVRCTTQATGLWTCDDYDSFFLGLPVALQAARACVCLSMAMGFLSCICAVFGMECTNVSAGNPKMKARMTLVAGLLNFIGGVSVGIAVSWFAANVLQEYWNPLGAATSNTRYVYGSALFVGWISMAVSVIAGLVQCCSSWSVDDEDNGRPYTYNPSKPKASSAEYI"

     polyA_site      751
                     /gene="LOC100183075"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      

aatttccatttttttacagttatttctgtatttttaattgctcgtatttatattgacaaaaatcaacaatggtaaacggcggtcttcaagttggtgggtttgttctgggccttatcgggtggatattgggcattgttacgtgtaccttaccggattggagaaagaacgacttgcaaggtgaagttattgagtcggtgatacgaactacgggcttatgggtgaggtgtaccacacaggcaactgggttatggacttgcgatgattatgattcatttttcttgggtttgcccgtcgctcttcaggccgccagagcatgtgtctgcctcagtatggcaatgggcttcttgtcctgtatttgcgccgtgttcggaatggaatgtactaatgtttcagctggtaacccgaaaatgaaggcaagaatgacactcgttgccggtttgttgaattttattgggggtgtttccgtcggaatagccgtgtcttggttcgctgccaacgttttgcaagaatattggaacccccttggagctgccaccagtaacacaagatatgtctacggatctgcactttttgttggatggatttccatggcagtcagtgtcattgctggacttgtacaatgttgttcatcatggagtgtcgatgacgaagataatggtcgcccttatacttacaatccatccaaaccaaaagcatcatcagctgaatatatttaaatattcaaaccaaaacattttctatcgttgcaacg

//