LOCUS       NM_072118                624 bp    mRNA    linear   INV 22-NOV-2023
DEFINITION  Caenorhabditis elegans Rab5-interacting protein (F44E7.9), mRNA.
ACCESSION   NM_072118
VERSION     NM_072118.5
DBLINK      BioProject: PRJNA158
KEYWORDS    RefSeq.
SOURCE      Caenorhabditis elegans
  ORGANISM  Caenorhabditis elegans
            Eukaryota; Metazoa; Ecdysozoa; Nematoda; Chromadorea; Rhabditida;
            Rhabditina; Rhabditomorpha; Rhabditoidea; Rhabditidae; Peloderinae;
            Caenorhabditis.
REFERENCE   1  (bases 1 to 624)
  AUTHORS   Sulson,J.E. and Waterston,R.
  CONSRTM   Caenorhabditis elegans Sequencing Consortium
  TITLE     Genome sequence of the nematode C. elegans: a platform for
            investigating biology
  JOURNAL   Science 282 (5396), 2012-2018 (1998)
   PUBMED   9851916
  REMARK    Erratum:[Science 1999 Jan 1;283(5398):35]
REFERENCE   2  (bases 1 to 624)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (22-NOV-2023) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 624)
  AUTHORS   WormBase.
  CONSRTM   WormBase Consortium
  TITLE     Direct Submission
  JOURNAL   Submitted (29-OCT-2023) WormBase Group, European Bioinformatics
            Institute, Cambridge, CB10 1SA, UK. Email: help@wormbase.org
REFERENCE   4  (bases 1 to 624)
  AUTHORS   Sulson,J.E. and Waterston,R.
  TITLE     Direct Submission
  JOURNAL   Submitted (03-MAR-2003) Nematode Sequencing Project: Sanger
            Institute, Hinxton, Cambridge CB10 1SA, UK and The Genome Institute
            at Washington University, St. Louis, MO 63110, USA
COMMENT     REVIEWED REFSEQ: This record has been curated by WormBase. This
            record is derived from an annotated genomic sequence (NC_003283).
            
            On Feb 2, 2021 this sequence version replaced NM_072118.4.
FEATURES             Location/Qualifiers
     source          1..624
                     /organism="Caenorhabditis elegans"
                     /mol_type="mRNA"
                     /strain="Bristol N2"
                     /db_xref="taxon:6239"
                     /chromosome="V"
     gene            1..624
                     /gene="F44E7.9"
                     /locus_tag="CELE_F44E7.9"
                     /db_xref="GeneID:185741"
                     /db_xref="WormBase:WBGene00018431"
     CDS             6..371
                     /gene="F44E7.9"
                     /locus_tag="CELE_F44E7.9"
                     /standard_name="F44E7.9"
                     /note="Confirmed by transcript evidence"
                     /codon_start=1
                     /product="Rab5-interacting protein"
                     /protein_id="NP_504519.1"
                     /db_xref="EnsemblGenomes-Gn:WBGene00018431"
                     /db_xref="EnsemblGenomes-Tr:F44E7.9"
                     /db_xref="GeneID:185741"
                     /db_xref="GOA:O16254"
                     /db_xref="InterPro:IPR010742"
                     /db_xref="InterPro:IPR029008"
                     /db_xref="UniProtKB/TrEMBL:O16254"
                     /db_xref="WormBase:WBGene00018431"
                     /translation="

MSSKSSAPLEPTWTETLAKGLTPRSEWPDKDELLDVVYWGKQVISLLLGFIFGITSLTGVLVLVCYVGTSSVIAHHFVTKFQRVDEEEVGGFWELSKEGFGAAFATFMVTWITTYTYSTQV"

     misc_feature    111..341
                     /gene="F44E7.9"
                     /locus_tag="CELE_F44E7.9"
                     /note="Rab5-interacting protein (Rab5ip); Region: Rab5ip;
                     pfam07019"
                     /db_xref="CDD:429250"
ORIGIN      

gtataatgtcgtccaaatcgtctgcaccactggaacccacgtggaccgagacgcttgccaaaggactcacacctcgctctgaatggccagacaaagacgaattattggatgttgtttactggggaaaacaggttatctccctgctgctgggcttcatcttcggaattacctcactaaccggagtcctcgttttagtctgctacgttggaacgtcttccgtcattgctcaccactttgttacaaaattccaacgagtggacgaagaagaagtcggaggattctgggaattgtcgaaagaaggattcggtgctgctttcgctaccttcatggttacgtggatcacaacctacacgtactcgacacaagtgtagagaccttggaaatatatattagtatttattgaattttgtttagtttacctcgacagttttgagccaaaagcaatcaaagttacaacttaaacatgttcgtgtgccgttcttcccttgttattccaaatatttaattttaaaattattttatttttgttctgtgatgtttttttgcgaattgtttatctttaaatagttaaatatcaaaccccaattgccttccgttcaaatatatgaatcactttgaattgaa

//