2025-07-02 10:36:27, GGRNA.v2 : RefSeq release 229 (Mar, 2025)
LOCUS NM_001318277 429 bp mRNA linear INV 04-DEC-2024 DEFINITION Caenorhabditis elegans Homeobox protein ceh-8 (ceh-8), partial mRNA. ACCESSION NM_001318277 VERSION NM_001318277.3 DBLINK BioProject: PRJNA158 KEYWORDS RefSeq. SOURCE Caenorhabditis elegans ORGANISM Caenorhabditis elegans Eukaryota; Metazoa; Ecdysozoa; Nematoda; Chromadorea; Rhabditida; Rhabditina; Rhabditomorpha; Rhabditoidea; Rhabditidae; Peloderinae; Caenorhabditis. REFERENCE 1 (bases 1 to 429) AUTHORS Sulson,J.E. and Waterston,R. CONSRTM Caenorhabditis elegans Sequencing Consortium TITLE Genome sequence of the nematode C. elegans: a platform for investigating biology JOURNAL Science 282 (5396), 2012-2018 (1998) PUBMED 9851916 REMARK Erratum:[Science 1999 Jan 1;283(5398):35] REFERENCE 2 (bases 1 to 429) CONSRTM NCBI Genome Project TITLE Direct Submission JOURNAL Submitted (04-DEC-2024) National Center for Biotechnology Information, NIH, Bethesda, MD 20894, USA REFERENCE 3 (bases 1 to 429) AUTHORS WormBase. CONSRTM WormBase Consortium TITLE Direct Submission JOURNAL Submitted (17-OCT-2024) WormBase Group, European Bioinformatics Institute, Cambridge, CB10 1SA, UK. Email: help@wormbase.org REFERENCE 4 (bases 1 to 429) AUTHORS Sulson,J.E. and Waterston,R. TITLE Direct Submission JOURNAL Submitted (03-MAR-2003) Nematode Sequencing Project: Sanger Institute, Hinxton, Cambridge CB10 1SA, UK and The Genome Institute at Washington University, St. Louis, MO 63110, USA COMMENT REVIEWED REFSEQ: This record has been curated by WormBase. This record is derived from an annotated genomic sequence (NC_003279). On Apr 15, 2020 this sequence version replaced NM_001318277.2. COMPLETENESS: incomplete on both ends. FEATURES Location/Qualifiers source 1..429 /organism="Caenorhabditis elegans" /mol_type="mRNA" /strain="Bristol N2" /db_xref="taxon:6239" /chromosome="I" gene <1..>429 /gene="ceh-8" /locus_tag="CELE_ZK265.4" /db_xref="GeneID:191617" /db_xref="WormBase:WBGene00000433" CDS 1..429 /gene="ceh-8" /locus_tag="CELE_ZK265.4" /standard_name="ZK265.4c" /note="Confirmed by transcript evidence" /codon_start=1 /product="Homeobox protein ceh-8" /protein_id="NP_001305206.1" /db_xref="GeneID:191617" /db_xref="WormBase:WBGene00000433" /translation="
MPSWSWMSENKTDTPPMLPPANTLSSTHNNGISDEFFKTSEGKEVYGFPFAEYGTPADNTHVSKTGNVFHLNFEDSDKKSMKKESPQTPSTSSPFISEYHPPFIPYYIPNQSFSNAFNQYPMPFPYPIHFEPPQLTHSQENC"
ORIGIN
atgccatcttggtcatggatgagtgagaataagacagatacaccgccaatgcttcctccagcaaatacactttcatcaactcataacaatggaatttccgatgaattcttcaagacttccgagggaaaagaagtttatgggtttccattcgctgaatatgggactccggcggacaacacgcacgtcagcaaaactggaaacgtttttcatttgaatttcgaagacagtgataagaaatcaatgaaaaaagaatcgcctcaaacaccatcgacaagtagtccattcatttcggaatatcatccaccatttatcccttattatattccaaatcaatcattttccaatgcatttaatcaatatccaatgccattcccctatccaattcactttgagccaccacaacttactcatagtcaggaaaattgttga
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]