GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2024-05-02 23:03:50, GGRNA.v2 : RefSeq release 222 (Jan, 2024)

LOCUS       NM_001136403             741 bp    mRNA    linear   INV 22-NOV-2023
DEFINITION  Caenorhabditis elegans F-box domain-containing protein
            (Y57G11C.499), partial mRNA.
ACCESSION   NM_001136403
VERSION     NM_001136403.3
DBLINK      BioProject: PRJNA158
KEYWORDS    RefSeq.
SOURCE      Caenorhabditis elegans
  ORGANISM  Caenorhabditis elegans
            Eukaryota; Metazoa; Ecdysozoa; Nematoda; Chromadorea; Rhabditida;
            Rhabditina; Rhabditomorpha; Rhabditoidea; Rhabditidae; Peloderinae;
            Caenorhabditis.
REFERENCE   1  (bases 1 to 741)
  AUTHORS   Sulson,J.E. and Waterston,R.
  CONSRTM   Caenorhabditis elegans Sequencing Consortium
  TITLE     Genome sequence of the nematode C. elegans: a platform for
            investigating biology
  JOURNAL   Science 282 (5396), 2012-2018 (1998)
   PUBMED   9851916
  REMARK    Erratum:[Science 1999 Jan 1;283(5398):35]
REFERENCE   2  (bases 1 to 741)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (22-NOV-2023) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 741)
  AUTHORS   WormBase.
  CONSRTM   WormBase Consortium
  TITLE     Direct Submission
  JOURNAL   Submitted (29-OCT-2023) WormBase Group, European Bioinformatics
            Institute, Cambridge, CB10 1SA, UK. Email: help@wormbase.org
REFERENCE   4  (bases 1 to 741)
  AUTHORS   Sulson,J.E. and Waterston,R.
  TITLE     Direct Submission
  JOURNAL   Submitted (03-MAR-2003) Nematode Sequencing Project: Sanger
            Institute, Hinxton, Cambridge CB10 1SA, UK and The Genome Institute
            at Washington University, St. Louis, MO 63110, USA
COMMENT     REVIEWED REFSEQ: This record has been curated by WormBase. This
            record is derived from an annotated genomic sequence (NC_003282).
            
            On Feb 2, 2021 this sequence version replaced NM_001136403.2.
            COMPLETENESS: incomplete on both ends.
FEATURES             Location/Qualifiers
     source          1..741
                     /organism="Caenorhabditis elegans"
                     /mol_type="mRNA"
                     /strain="Bristol N2"
                     /db_xref="taxon:6239"
                     /chromosome="IV"
     gene            <1..>741
                     /gene="Y57G11C.499"
                     /locus_tag="CELE_Y57G11C.499"
                     /db_xref="GeneID:7040135"
                     /db_xref="WormBase:WBGene00077762"
     CDS             1..741
                     /gene="Y57G11C.499"
                     /locus_tag="CELE_Y57G11C.499"
                     /standard_name="Y57G11C.499"
                     /note="Partially confirmed by transcript evidence"
                     /codon_start=1
                     /product="F-box domain-containing protein"
                     /protein_id="NP_001129875.1"
                     /db_xref="EnsemblGenomes-Gn:WBGene00077762"
                     /db_xref="EnsemblGenomes-Tr:Y57G11C.499"
                     /db_xref="GeneID:7040135"
                     /db_xref="InterPro:IPR001810"
                     /db_xref="InterPro:IPR002900"
                     /db_xref="InterPro:IPR040161"
                     /db_xref="UniProtKB/TrEMBL:B3GWE2"
                     /db_xref="WormBase:WBGene00077762"
                     /translation="
MEEKLKDELNSIKIFNGLSLSRMPTVVVHGVVDNLLEQREPIDRCFLSKVCRQMRDVIYSKDLGFKKVGVHFNMYYLSLCLDNVSFTYKNDESGCNAKCDGRQDELIKKDKLNSFLDDFAIVMKNRKLRLDEFEISGNTFISSERIETLETGVVEWMKKNSIMEKQFKTKKVRLAEVKSDYVIDILSLFKPGVLEKIEINWKKWPASYFDDIDALFELDQWKQANVNWLASSTISNFSFKININFK"
     misc_feature    58..204
                     /gene="Y57G11C.499"
                     /locus_tag="CELE_Y57G11C.499"
                     /note="F-box domain superfamily; Region: F-box_SF;
                     cl45894"
                     /db_xref="CDD:459239"
     misc_feature    order(67..72,76..84,91..96,103..105,148..156,160..162,
                     169..171)
                     /gene="Y57G11C.499"
                     /locus_tag="CELE_Y57G11C.499"
                     /note="F-box motif; other site"
                     /db_xref="CDD:438852"
     misc_feature    order(67..69,79..81,88..93,100..105,127..129,133..138,
                     148..156,160..162)
                     /gene="Y57G11C.499"
                     /locus_tag="CELE_Y57G11C.499"
                     /note="Skp1 binding site [polypeptide binding]; other
                     site"
                     /db_xref="CDD:438852"
     misc_feature    457..>672
                     /gene="Y57G11C.499"
                     /locus_tag="CELE_Y57G11C.499"
                     /note="FTH domain; Region: FTH; pfam01827"
                     /db_xref="CDD:396410"
ORIGIN      
atggaggagaaattgaaggacgagttgaattcgatcaaaatcttcaatggtttatcactcagccgcatgccaacggtagtggttcacggagttgtggacaatctcttagagcaaagggagccaattgatagatgctttctctccaaagtgtgccgtcaaatgcgagatgtgatctatagcaaagatcttggattcaagaaagtgggcgtgcacttcaatatgtattatttgtcactgtgcctggataatgtctcattcacctataagaatgacgagtccggttgtaatgcgaaatgcgacggtcgccaggatgaattgatcaaaaaagacaaattgaattcgtttttggatgatttcgccatagtgatgaagaaccgaaaacttcgattggatgaattcgaaatttctggaaatacgttcatcagttcggaacgtatcgaaacattagaaaccggagtcgtagagtggatgaagaagaattcgatcatggaaaagcaatttaaaaccaaaaaagtccgtctcgcagaagtgaagtctgattatgtaatcgatattctgtctctcttcaaacctggagttctcgaaaaaattgagatcaactggaaaaagtggccagcctcttatttcgatgatatcgatgctttgtttgaattggaccaatggaaacaggcaaatgttaattggctggcttcgtctactatctccaatttttcatttaaaatcaatattaattttaaataa
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]