2024-04-29 16:28:45, GGRNA.v2 : RefSeq release 222 (Jan, 2024)
LOCUS NM_179778 792 bp mRNA linear PLN 20-OCT-2022 DEFINITION Arabidopsis thaliana histone deacetylase-related / HD-like protein (HDT4), mRNA. ACCESSION NM_179778 VERSION NM_179778.1 DBLINK BioProject: PRJNA116 BioSample: SAMN03081427 KEYWORDS RefSeq. SOURCE Arabidopsis thaliana (thale cress) ORGANISM Arabidopsis thaliana Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta; Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis. REFERENCE 1 (bases 1 to 792) AUTHORS Lin,X., Kaul,S., Rounsley,S., Shea,T.P., Benito,M.I., Town,C.D., Fujii,C.Y., Mason,T., Bowman,C.L., Barnstead,M., Feldblyum,T.V., Buell,C.R., Ketchum,K.A., Lee,J., Ronning,C.M., Koo,H.L., Moffat,K.S., Cronin,L.A., Shen,M., Pai,G., Van Aken,S., Umayam,L., Tallon,L.J., Gill,J.E., Adams,M.D., Carrera,A.J., Creasy,T.H., Goodman,H.M., Somerville,C.R., Copenhaver,G.P., Preuss,D., Nierman,W.C., White,O., Eisen,J.A., Salzberg,S.L., Fraser,C.M. and Venter,J.C. TITLE Sequence and analysis of chromosome 2 of the plant Arabidopsis thaliana JOURNAL Nature 402 (6763), 761-768 (1999) PUBMED 10617197 REFERENCE 2 (bases 1 to 792) CONSRTM NCBI Genome Project TITLE Direct Submission JOURNAL Submitted (19-OCT-2022) National Center for Biotechnology Information, NIH, Bethesda, MD 20894, USA REFERENCE 3 (bases 1 to 792) AUTHORS Krishnakumar,V., Cheng,C.-Y., Chan,A.P., Schobel,S., Kim,M., Ferlanti,E.S., Belyaeva,I., Rosen,B.D., Micklem,G., Miller,J.R., Vaughn,M. and Town,C.D. TITLE Direct Submission JOURNAL Submitted (17-MAY-2016) Plant Genomics, J. Craig Venter Institute, 9704 Medical Center Dr, Rockville, MD 20850, USA REMARK Protein update by submitter REFERENCE 4 (bases 1 to 792) AUTHORS Swarbreck,D., Lamesch,P., Wilks,C. and Huala,E. CONSRTM TAIR TITLE Direct Submission JOURNAL Submitted (18-FEB-2011) Department of Plant Biology, Carnegie Institution, 260 Panama Street, Stanford, CA, USA COMMENT REVIEWED REFSEQ: This record has been curated by TAIR and Araport. This record is derived from an annotated genomic sequence (NC_003071). FEATURES Location/Qualifiers source 1..792 /organism="Arabidopsis thaliana" /mol_type="mRNA" /db_xref="taxon:3702" /chromosome="2" /ecotype="Columbia" gene 1..792 /gene="HDT4" /locus_tag="AT2G27840" /gene_synonym="F15K20.6; F15K20_6; HD2D; HDA13; HDT04; HISTONE DEACETYLASE; HISTONE DEACETYLASE 13; histone deacetylase 2D" /note="Belongs to the plant specific HD2 type proteins; similar to nucleolar Zea mays histone deacetylase; HD2-p39" /db_xref="Araport:AT2G27840" /db_xref="GeneID:817331" /db_xref="TAIR:AT2G27840" CDS 68..613 /gene="HDT4" /locus_tag="AT2G27840" /gene_synonym="F15K20.6; F15K20_6; HD2D; HDA13; HDT04; HISTONE DEACETYLASE; HISTONE DEACETYLASE 13; histone deacetylase 2D" /inference="Similar to RNA sequence, EST:INSD:EL986417.1,INSD:ES018493.1,INSD:DR297197.1, INSD:DR379173.1,INSD:DR373732.1,INSD:BP671651.1, INSD:Z26451.1,INSD:AI999559.1,INSD:DR325152.1, INSD:ES111786.1,INSD:ES131334.1,INSD:EH909696.1" /inference="similar to RNA sequence, mRNA:INSD:BT008535.1,INSD:AF255713.1" /note="HDT4; FUNCTIONS IN: histone deacetylase activity; INVOLVED IN: production of siRNA involved in RNA interference; LOCATED IN: nucleolus; EXPRESSED IN: 22 plant structures; EXPRESSED DURING: 13 growth stages; BEST Arabidopsis thaliana protein match is: histone deacetylase 2B (TAIR:AT5G22650.2); Has 725 Blast hits to 661 proteins in 171 species: Archae - 0; Bacteria - 166; Metazoa - 184; Fungi - 55; Plants - 136; Viruses - 17; Other Eukaryotes - 167 (source: NCBI BLink)." /codon_start=1 /product="histone deacetylase-related / HD-like protein" /protein_id="NP_850109.1" /db_xref="Araport:AT2G27840" /db_xref="GeneID:817331" /db_xref="TAIR:AT2G27840" /translation="
MVHASQVTLGDVEKVKKDETFAVYVKIGDDENGFMIGNLSQKFPQFSIDLYLGHEFEISHNSTSSVYLIGYRTFDAFDELDEEIDSDSELDEYMEQQIAALPQNEINPEEDDESDSDEMGLDEDDDSSDEEDVEAEAPLKVAPPSKKMPNGAFEIAKGGKKNKSSGGKKRCPFPCGPSCKK"
misc_feature <71..280 /gene="HDT4" /locus_tag="AT2G27840" /gene_synonym="F15K20.6; F15K20_6; HD2D; HDA13; HDT04; HISTONE DEACETYLASE; HISTONE DEACETYLASE 13; histone deacetylase 2D" /note="Nucleoplasmin-like domain; Region: NPL; pfam17800" /db_xref="CDD:436054" ORIGIN
atgttcaattttaggtatcgagattaagccagggaagccatttaaggtgatacaaaaagatggattcatggtccatgcctctcaggttacccttggtgacgttgagaaggttaaaaaagatgagacttttgccgtttatgtgaagattggtgatgatgagaatgggtttatgattggaaatctctcacagaagtttcctcaattttctattgatctctacttagggcacgagtttgagatttctcacaacagtacaagcagtgtctatcttattggttacaggacctttgatgcttttgacgaactggatgaggagattgattctgattctgagttagatgaatatatggaacaacaaattgctgctttgcctcaaaatgagatcaatcctgaagaagatgatgaatccgactcagatgagatgggtttggacgaggatgatgactcttcagatgaagaagatgtagaggctgaagcacctttaaaggtggctcctccgagcaaaaagatgccaaatggtgcatttgagatagctaaaggtggaaagaagaacaagtcatcaggagggaagaagagatgcccattcccttgtggtccctcttgcaaaaagtagaagatatttgcacaccaagtcacatttttccaatagaaatttttacttgactgtattggtgaatcgttgagtgacttatgaggcttttggcatcttaaaatttttggattattataatatatgttatgttgtcattttggagtgttaatgggtttaaatgaaatatgatttttgctctt
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]