GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2024-05-06 00:49:53, GGRNA.v2 : RefSeq release 222 (Jan, 2024)

LOCUS       NM_125325               1276 bp    mRNA    linear   PLN 20-OCT-2022
DEFINITION  Arabidopsis thaliana WUSCHEL related homeobox 2 (WOX2), mRNA.
ACCESSION   NM_125325
VERSION     NM_125325.3
DBLINK      BioProject: PRJNA116
            BioSample: SAMN03081427
KEYWORDS    RefSeq.
SOURCE      Arabidopsis thaliana (thale cress)
  ORGANISM  Arabidopsis thaliana
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
            Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae;
            Pentapetalae; rosids; malvids; Brassicales; Brassicaceae;
            Camelineae; Arabidopsis.
REFERENCE   1  (bases 1 to 1276)
  AUTHORS   Tabata,S., Kaneko,T., Nakamura,Y., Kotani,H., Kato,T., Asamizu,E.,
            Miyajima,N., Sasamoto,S., Kimura,T., Hosouchi,T., Kawashima,K.,
            Kohara,M., Matsumoto,M., Matsuno,A., Muraki,A., Nakayama,S.,
            Nakazaki,N., Naruo,K., Okumura,S., Shinpo,S., Takeuchi,C., Wada,T.,
            Watanabe,A., Yamada,M., Yasuda,M., Sato,S., de la Bastide,M.,
            Huang,E., Spiegel,L., Gnoj,L., O'Shaughnessy,A., Preston,R.,
            Habermann,K., Murray,J., Johnson,D., Rohlfing,T., Nelson,J.,
            Stoneking,T., Pepin,K., Spieth,J., Sekhon,M., Armstrong,J.,
            Becker,M., Belter,E., Cordum,H., Cordes,M., Courtney,L.,
            Courtney,W., Dante,M., Du,H., Edwards,J., Fryman,J., Haakensen,B.,
            Lamar,E., Latreille,P., Leonard,S., Meyer,R., Mulvaney,E.,
            Ozersky,P., Riley,A., Strowmatt,C., Wagner-McPherson,C., Wollam,A.,
            Yoakum,M., Bell,M., Dedhia,N., Parnell,L., Shah,R., Rodriguez,M.,
            See,L.H., Vil,D., Baker,J., Kirchoff,K., Toth,K., King,L.,
            Bahret,A., Miller,B., Marra,M., Martienssen,R., McCombie,W.R.,
            Wilson,R.K., Murphy,G., Bancroft,I., Volckaert,G., Wambutt,R.,
            Dusterhoft,A., Stiekema,W., Pohl,T., Entian,K.D., Terryn,N.,
            Hartley,N., Bent,E., Johnson,S., Langham,S.A., McCullagh,B.,
            Robben,J., Grymonprez,B., Zimmermann,W., Ramsperger,U., Wedler,H.,
            Balke,K., Wedler,E., Peters,S., van Staveren,M., Dirkse,W.,
            Mooijman,P., Lankhorst,R.K., Weitzenegger,T., Bothe,G., Rose,M.,
            Hauf,J., Berneiser,S., Hempel,S., Feldpausch,M., Lamberth,S.,
            Villarroel,R., Gielen,J., Ardiles,W., Bents,O., Lemcke,K.,
            Kolesov,G., Mayer,K., Rudd,S., Schoof,H., Schueller,C.,
            Zaccaria,P., Mewes,H.W., Bevan,M. and Fransz,P.
  CONSRTM   Kazusa DNA Research Institute; Cold Spring Harbor and Washington
            University in St Louis Sequencing Consortium; European Union
            Arabidopsis Genome Sequencing Consortium
  TITLE     Sequence and analysis of chromosome 5 of the plant Arabidopsis
            thaliana
  JOURNAL   Nature 408 (6814), 823-826 (2000)
   PUBMED   11130714
REFERENCE   2  (bases 1 to 1276)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (19-OCT-2022) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 1276)
  AUTHORS   Krishnakumar,V., Cheng,C.-Y., Chan,A.P., Schobel,S., Kim,M.,
            Ferlanti,E.S., Belyaeva,I., Rosen,B.D., Micklem,G., Miller,J.R.,
            Vaughn,M. and Town,C.D.
  TITLE     Direct Submission
  JOURNAL   Submitted (17-MAY-2016) Plant Genomics, J. Craig Venter Institute,
            9704 Medical Center Dr, Rockville, MD 20850, USA
  REMARK    Protein update by submitter
REFERENCE   4  (bases 1 to 1276)
  AUTHORS   Swarbreck,D., Lamesch,P., Wilks,C. and Huala,E.
  CONSRTM   TAIR
  TITLE     Direct Submission
  JOURNAL   Submitted (18-FEB-2011) Department of Plant Biology, Carnegie
            Institution, 260 Panama Street, Stanford, CA, USA
COMMENT     REVIEWED REFSEQ: This record has been curated by TAIR and Araport.
            This record is derived from an annotated genomic sequence
            (NC_003076).
            
            On Sep 12, 2016 this sequence version replaced NM_125325.2.
FEATURES             Location/Qualifiers
     source          1..1276
                     /organism="Arabidopsis thaliana"
                     /mol_type="mRNA"
                     /db_xref="taxon:3702"
                     /chromosome="5"
                     /ecotype="Columbia"
     gene            1..1276
                     /gene="WOX2"
                     /locus_tag="AT5G59340"
                     /gene_synonym="MNC17.25; MNC17_25; WUSCHEL related
                     homeobox 2"
                     /note="Encodes a WUSCHEL-related homeobox gene family
                     member with 65 amino acids in its homeodomain. Proteins in
                     this family contain a sequence of eight residues
                     (TLPLFPMH) downstream of the homeodomain called the WUS
                     box. WOX2 has a putative Zinc finger domain downstream of
                     the homeodomain. Transcripts are expressed in the egg
                     cell, the zygote and the apical cell lineage and are
                     reduced in met3-1 early embryos. This gene is necessary
                     for cell divisions that form the apical embryo domain."
                     /db_xref="Araport:AT5G59340"
                     /db_xref="GeneID:836053"
                     /db_xref="TAIR:AT5G59340"
     CDS             424..1206
                     /gene="WOX2"
                     /locus_tag="AT5G59340"
                     /gene_synonym="MNC17.25; MNC17_25; WUSCHEL related
                     homeobox 2"
                     /inference="Similar to RNA sequence,
                     EST:INSD:EL243972.1,INSD:DR751059.1,INSD:EL057549.1,
                     INSD:DR751060.1"
                     /inference="similar to RNA sequence,
                     mRNA:INSD:AY251393.1,INSD:AY251392.1"
                     /note="WUSCHEL related homeobox 2 (WOX2); CONTAINS
                     InterPro DOMAIN/s: Homeobox (InterPro:IPR001356),
                     Homeodomain-like (InterPro:IPR009057); BEST Arabidopsis
                     thaliana protein match is: WUSCHEL related homeobox 1
                     (TAIR:AT3G18010.1); Has 921 Blast hits to 921 proteins in
                     61 species: Archae - 0; Bacteria - 0; Metazoa - 0; Fungi -
                     0; Plants - 921; Viruses - 0; Other Eukaryotes - 0
                     (source: NCBI BLink)."
                     /codon_start=1
                     /product="WUSCHEL related homeobox 2"
                     /protein_id="NP_200742.2"
                     /db_xref="GeneID:836053"
                     /db_xref="TAIR:AT5G59340"
                     /db_xref="Araport:AT5G59340"
                     /translation="
MENEVNAGTASSSRWNPTKDQITLLENLYKEGIRTPSADQIQQITGRLRAYGHIEGKNVFYWFQNHKARQRQKQKQERMAYFNRLLHKTSRFFYPPPCSNVGCVSPYYLQQASDHHMNQHGSVYTNDLLHRNNVMIPSGGYEKRTVTQHQKQLSDIRTTAATRMPISPSSLRFDRFALRDNCYAGEDINVNSSGRKTLPLFPLQPLNASNADGMGSSSFALGSDSPVDCSSDGAGREQPFIDFFSGGSTSTRFDSNGNGL"
     misc_feature    460..636
                     /gene="WOX2"
                     /locus_tag="AT5G59340"
                     /gene_synonym="MNC17.25; MNC17_25; WUSCHEL related
                     homeobox 2"
                     /note="Homeobox domain; Region: Homeobox; pfam00046"
                     /db_xref="CDD:425441"
     misc_feature    order(463..468,472..474,526..528,544..546,595..597,
                     601..606,613..618,622..630,634..639)
                     /gene="WOX2"
                     /locus_tag="AT5G59340"
                     /gene_synonym="MNC17.25; MNC17_25; WUSCHEL related
                     homeobox 2"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:238039"
     misc_feature    order(469..471,604..606,613..618,625..627)
                     /gene="WOX2"
                     /locus_tag="AT5G59340"
                     /gene_synonym="MNC17.25; MNC17_25; WUSCHEL related
                     homeobox 2"
                     /note="specific DNA base contacts [nucleotide binding];
                     other site"
                     /db_xref="CDD:238039"
ORIGIN      
aagtattactgtgttatctctttttctatttgccgcattttgataaattaattataaaatgcaacatgctttttttttttttccgcgtatgtgccaatgcaacatgcttttattaaaaaaaaaacgaatagatccaaaatgtttttttttcctttctatttgtcttctcataaaaaagtagcctcttttttaccatctcagccgctccacgcgatgttttcagagtctccagcgcaaaaaacaacacgcatgtcactatctctctcttcatttgactctgttccaatccctcactaactcgctatataaatatgagagcctccccatgaatttcatgcatcattcaacccccataacctacatgcaaaccatcgtcttaaaaccctagttctccataaaaaaaatatccttgaacacaaataaatggaaaacgaagtaaacgcaggaacagcaagcagttcaagatggaacccaacgaaagatcagatcacgctactggaaaatctttacaaggaaggaatacgaactccgagcgccgatcagattcagcagatcaccggtaggcttcgtgcgtacggccatatcgaaggtaaaaacgtcttttactggttccagaaccataaggctaggcaacgccaaaagcagaaacaggagcgcatggcttacttcaatcgcctcctccacaaaacctcccgtttcttctacccccctccttgctcaaacgtgggttgtgtcagtccgtactatttacagcaagcaagtgatcatcatatgaatcaacatggaagtgtatacacaaacgatcttcttcacagaaacaatgtgatgattccaagtggtggctacgagaaacggacagtcacacaacatcagaaacaactttcagacataagaacaacagcagccacaagaatgccaatttctccgagttcactcagatttgacagatttgccctccgtgataactgttatgccggtgaggacattaacgtcaattccagtggacggaaaacactccctctttttcctcttcagcctttgaatgcaagtaatgctgatggtatgggaagttccagttttgcccttggtagtgattctccggtggattgttctagcgatggagccggccgagagcagccgtttattgatttcttttctggtggttctacttctactcgtttcgatagtaatggtaatgggttgtaacgaaggtttaatgaaattataaattttatgtaatcattagttgttttaaaaagtatttcaaactgtggag
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]