GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2026-05-16 17:57:00, GGRNA.v2 : RefSeq release 233 (Jan, 2026)

LOCUS       XM_078012759             496 bp    mRNA    linear   INV 09-DEC-2025
DEFINITION  PREDICTED: Saccoglossus kowalevskii protein argonaute-2-like
            (LOC144359645), partial mRNA.
ACCESSION   XM_078012759
VERSION     XM_078012759.1
DBLINK      BioProject: PRJNA42857
KEYWORDS    RefSeq.
SOURCE      Saccoglossus kowalevskii
  ORGANISM  Saccoglossus kowalevskii
            Eukaryota; Metazoa; Hemichordata; Enteropneusta; Harrimaniidae;
            Saccoglossus.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NW_003141868.1) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_000003605.3-RS_2025_12
            Annotation Pipeline         :: NCBI Eukaryotic Genome Annotation
                                           Pipeline (EGAP)
            Annotation Software Version :: 10.5
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/05/2025
            ##Genome-Annotation-Data-END##
            COMPLETENESS: incomplete on the 5' end.
FEATURES             Location/Qualifiers
     source          1..496
                     /organism="Saccoglossus kowalevskii"
                     /mol_type="mRNA"
                     /isolation_source="beach area of Waquoit Pond near Woods
                     Hole, MA"
                     /db_xref="taxon:10224"
                     /chromosome="Unknown"
                     /sex="male"
                     /tissue_type="testes"
                     /geo_loc_name="USA: MA"
     gene            <1..496
                     /gene="LOC144359645"
                     /note="protein argonaute-2-like; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 15
                     long SRA reads, and 88% coverage of the annotated genomic
                     feature by RNAseq alignments, including 7 samples with
                     support for all annotated introns"
                     /db_xref="GeneID:144359645"
     CDS             <1..407
                     /gene="LOC144359645"
                     /codon_start=3
                     /product="protein argonaute-2-like"
                     /protein_id="XP_077868885.1"
                     /db_xref="GeneID:144359645"
                     /translation="
SATAFYKSQSVIDFLCEVLDFRDINEQRRPLTDSQRVKFTKEIKGLKVEITHCGTMRRKYRVCNVTRRPAQTQTFPLQLESGQTVECTVAKYFKDRHKLNLQYPYLPCLQVGQEQKHTYLPLEVSIVFYSLVVL"
     misc_feature    24..374
                     /gene="LOC144359645"
                     /note="PAZ domain, argonaute_like subfamily. Argonaute is
                     part of the RNA-induced silencing complex (RISC), and is
                     an endonuclease that plays a key role in the RNA
                     interference pathway. The PAZ domain has been named after
                     the proteins Piwi,Argonaut, and Zwille; Region:
                     PAZ_argonaute_like; cd02846"
                     /db_xref="CDD:239212"
     misc_feature    order(180..182,225..227,267..269,279..281,333..335,
                     354..356,360..362)
                     /gene="LOC144359645"
                     /note="nucleic acid-binding interface [nucleotide
                     binding]; other site"
                     /db_xref="CDD:239212"
ORIGIN      
tgtctgccactgccttttataagtcacagtcagttatagattttctgtgtgaagtcttggatttccgcgatataaatgaacaacgtagacctttaacagactctcaaagggttaaatttactaaagaaattaaaggtttgaaagttgaaatcacccactgtggtactatgcgaagaaaatacagagtgtgcaatgtgacaagacgaccagcacaaactcaaacatttccacttcagttagagtctggtcagactgtagagtgtactgtggctaaatattttaaagatagacataagttaaatttacagtatccttatctaccatgtttacaagttggacaagaacaaaaacatacttacctgccattggaggttagcattgtattctatagtcttgtagtgctctgattcagacagtactgtcatgtagtcttgatgtgtgatttacattgctttatagtttgatagtttgaattctctagtctagtcaacatgtt
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]