LOCUS       XM_077356046             878 bp    mRNA    linear   PLN 29-SEP-2025
DEFINITION  PREDICTED: Tasmannia lanceolata testis- and ovary-specific PAZ
            domain protein (LOC143847268), mRNA.
ACCESSION   XM_077356046
VERSION     XM_077356046.1
DBLINK      BioProject: PRJNA1335178
KEYWORDS    RefSeq.
SOURCE      Tasmannia lanceolata
  ORGANISM  Tasmannia lanceolata
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
            Spermatophyta; Magnoliopsida; Magnoliidae; Canellales; Winteraceae;
            Tasmannia.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NW_027518692) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_043159265.1-RS_2025_09
            Annotation Pipeline         :: NCBI Eukaryotic Genome Annotation
                                           Pipeline (EGAP)
            Annotation Software Version :: 10.5
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 09/26/2025
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..878
                     /organism="Tasmannia lanceolata"
                     /mol_type="mRNA"
                     /isolate="RefF3"
                     /db_xref="taxon:3420"
                     /chromosome="Unknown"
                     /sex="female"
                     /tissue_type="Young leaf"
                     /dev_stage="Mature"
                     /geo_loc_name="Australia: Victoria, East Gippsland,
                     Peppermint Ridge Farm"
                     /collection_date="2022-06-09"
                     /collected_by="Tania Zhang"
     gene            1..878
                     /gene="LOC143847268"
                     /note="testis- and ovary-specific PAZ domain protein;
                     Derived by automated computational analysis using gene
                     prediction method: Gnomon. Supporting evidence includes
                     similarity to: 3 Proteins, and 100% coverage of the
                     annotated genomic feature by RNAseq alignments, including
                     8 samples with support for all annotated introns"
                     /db_xref="GeneID:143847268"
     CDS             52..600
                     /gene="LOC143847268"
                     /codon_start=1
                     /product="testis- and ovary-specific PAZ domain protein"
                     /protein_id="XP_077212161.1"
                     /db_xref="GeneID:143847268"
                     /translation="

MSGGTPRAGGYMMRQRYSQEYGSSSDDLEEQDDALSRPSQPISKPQIIETILWLTSAAFFVYLGDRKSNLISLLWGDDRINRIALYLGLVGNFFNVGFILYTILFTRRGIKKVDEIWEASPPSAAPVVTINGLISFCLLSFALWPIWSFLTLPLLFTLCMAFIVISPYLPIGTFSSQDRRTF"

     misc_feature    184..558
                     /gene="LOC143847268"
                     /note="TMEM128 protein; Region: TMEM128; pfam20479"
                     /db_xref="CDD:466628"
ORIGIN      

aataaattttttattgttcatttttgggttaatttgtgtgaagatccatcaatgtccggtggaacccctagggcgggtgggtatatgatgaggcaaagatacagtcaggaatacgggtcgagcagtgatgatctcgaggagcaggacgatgcattgtcgagaccatcacaaccaatttccaaacctcagatcatcgaaactattctttggctcacctcagcagctttctttgtctaccttggtgatcgaaaatcaaatttaatctctcttttatggggcgatgatcggatcaacagaatagcgttgtaccttgggttagttggtaatttttttaatgtaggtttcatcttgtatacaattcttttcacacggcggggcatcaagaaggttgatgagatatgggaagcatcacctccatctgctgctccagttgtgaccataaatgggctaatatcattttgcttgctctcatttgctctgtggccaatttggagtttcttgacccttccccttctgttcacactatgtatggctttcattgttatatcaccatatttgccaattgggacattcagctcacaagacaggcgaacattttaaacatgaaatgaatagtacccatccatagttgcagccaaagaccttccccatgttgagaaatccgtcaaatttacaattgctaagatgatgcaaatgaggattatatttccatccaagttgagttagcatttgatgggggattgcattgatttatgatcattccaatgacatgcatcatttggatttgcttcaatttttattgtttctattgcttaactgaaactaaagaattccataattaaggtgaaattacaattttgtataattttagagtaaga

//