GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2026-05-16 17:39:10, GGRNA.v2 : RefSeq release 233 (Jan, 2026)

LOCUS       XM_075371524             719 bp    mRNA    linear   INV 16-JUL-2025
DEFINITION  PREDICTED: Lycorma delicatula protein argonaute-1-like
            (LOC142328057), transcript variant X3, mRNA.
ACCESSION   XM_075371524
VERSION     XM_075371524.1
DBLINK      BioProject: PRJNA1291225
KEYWORDS    RefSeq.
SOURCE      Lycorma delicatula (spotted lanternfly)
  ORGANISM  Lycorma delicatula
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Paraneoptera; Hemiptera; Auchenorrhyncha;
            Fulgoroidea; Fulgoridae; Aphaeninae; Lycorma.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_134461) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_047948215.1-RS_2025_07
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.4
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 07/15/2025
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..719
                     /organism="Lycorma delicatula"
                     /mol_type="mRNA"
                     /isolate="Av1"
                     /isolation_source="Kean University campus"
                     /db_xref="taxon:130591"
                     /chromosome="7"
                     /sex="female"
                     /tissue_type="Whole Insect"
                     /dev_stage="adult"
                     /geo_loc_name="USA: Kean University, Union, NJ"
                     /collection_date="2023-09-23"
                     /collected_by="Brenna Levine"
     gene            1..719
                     /gene="LOC142328057"
                     /note="protein argonaute-1-like; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 100%
                     coverage of the annotated genomic feature by RNAseq
                     alignments, including 4 samples with support for all
                     annotated introns"
                     /db_xref="GeneID:142328057"
     CDS             72..611
                     /gene="LOC142328057"
                     /codon_start=1
                     /product="protein argonaute-1-like isoform X2"
                     /protein_id="XP_075227639.1"
                     /db_xref="GeneID:142328057"
                     /translation="
MFYSGYRFVAVGRSFFTPPQQEQIVDLGDGLELRYGFYQSAILGWKPFLNVDVAHKGFSKPENLIKVIRDQNATIGDRVFDKELDNWQKESLQKYIGGLKVEYEIPNQPDSKRTYKVNRVLGSSINQRFDLVEKVGDAQRTKNISVGQYLHQYKNFRLRYPNMPCLHVGPSQRNIFVPY"
     misc_feature    99..245
                     /gene="LOC142328057"
                     /note="Argonaute linker 1 domain; Region: ArgoL1;
                     pfam08699"
                     /db_xref="CDD:462567"
     misc_feature    258..605
                     /gene="LOC142328057"
                     /note="PAZ domain, argonaute_like subfamily. Argonaute is
                     part of the RNA-induced silencing complex (RISC), and is
                     an endonuclease that plays a key role in the RNA
                     interference pathway. The PAZ domain has been named after
                     the proteins Piwi,Argonaut, and Zwille; Region:
                     PAZ_argonaute_like; cd02846"
                     /db_xref="CDD:239212"
     misc_feature    order(414..416,456..458,507..509,519..521,573..575,
                     594..596,600..602)
                     /gene="LOC142328057"
                     /note="nucleic acid-binding interface [nucleotide
                     binding]; other site"
                     /db_xref="CDD:239212"
ORIGIN      
gttgggattcgtcgaagtgaatatgagtgcagtgacgttgttcaaataactattcaggaggtttgcaatttatgttttattctggatacagatttgttgctgttgggcgttcattttttactccacctcagcaagaacaaattgttgatcttggagatggtttagaactacggtatggtttctaccaaagtgcgattcttggctggaagccatttcttaatgttgatgtcgcccacaaaggtttttcgaaaccagaaaatctaataaaagtaattagggatcaaaatgcaactattggtgatagagtatttgataaagagttagataattggcaaaaggagagtttacaaaagtatattggtggtctgaaagtggagtatgaaataccaaaccaacctgattctaaaagaacttacaaagttaatagagtgttgggaagtagtatcaatcagagatttgatttggttgaaaaagtcggagatgctcaaagaactaagaatattagtgtcggacagtatcttcatcagtataaaaacttcagacttagatatccaaatatgccttgtttacatgtcggaccatcacaaagaaacatatttgttccatattagttttaaagatatctgatgtaaaacacaaaaattggggataaaaaataacgcgtttttgggtttaatggaaaaaaactttgttaagtgtttaattaaggtatatatttt
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]