2025-10-18 13:20:10, GGRNA.v2 : RefSeq release 232 (Sep, 2025)
LOCUS XM_068326414 1430 bp mRNA linear VRT 14-SEP-2024 DEFINITION PREDICTED: Antennarius striatus vimentin-related 2 (vimr2), mRNA. ACCESSION XM_068326414 VERSION XM_068326414.1 DBLINK BioProject: PRJNA1159349 KEYWORDS RefSeq; includes ab initio. SOURCE Antennarius striatus (striated frogfish) ORGANISM Antennarius striatus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Actinopterygii; Neopterygii; Teleostei; Neoteleostei; Acanthomorphata; Eupercaria; Lophiiformes; Antennarioidei; Antennariidae; Antennarius. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_090785) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_040054535.1-RS_2024_09 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 09/13/2024 ##Genome-Annotation-Data-END## ##RefSeq-Attributes-START## ab initio :: 2% of CDS bases ##RefSeq-Attributes-END## FEATURES Location/Qualifiers source 1..1430 /organism="Antennarius striatus" /mol_type="mRNA" /isolate="MH-2024" /db_xref="taxon:241820" /chromosome="10" /sex="female" /tissue_type="kidney" /dev_stage="adult" gene 1..1430 /gene="vimr2" /note="vimentin-related 2; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 3 Proteins" /db_xref="GeneID:137603174" CDS 130..1266 /gene="vimr2" /codon_start=1 /product="vimentin" /protein_id="XP_068182515.1" /db_xref="GeneID:137603174" /translation="
MAVIRVSSYRKLFEDDHWRGNVGLSARCAGQYQASIRAADKRYCENLDFATAKKLNIEGLNCFLQDRIVITSLNDRLVRLIELARCFEEENESLECQIDDLEEKLYRRKASFSNTSAAAEPESGLDAVVENLRRERDEILNDTEELRKELECLMKHCENATHRRTLLQREQQNVAEAVDGVTAGCLALREQVSIYEKQLDNMEAQKALESLLEPVEGITGALAAIKYGSPDIAPALDVKEFYCQLAERLKFDCGATSSAVVCNGYRKQLDKEGAVKSKDISEMKMMTYKLQKKLAVLEKYNNELEEEFSMRNAAYADEIAELESTIDEMQHQEAKLKVQMKEQCEDYKELLSEKMARDMEIAAYRSLVEEEEERLSKM"
misc_feature 322..1251 /gene="vimr2" /note="Intermediate filament protein; Region: Filament; pfam00038" /db_xref="CDD:459643" ORIGIN
agtctgttcagtggtcagtgggggattcctcacttcagtgctacattctgattatctgtgaatataaactcccccactttggacctgttaccaacatttgcctgttgtggtgcagcctagtttgaagccatggccgttatcagggtgtcttcttaccgcaagctgttcgaggatgatcactggagaggaaatgtagggttgagtgcgaggtgtgccgggcagtaccaggcctccatcagagctgcggacaagcgttactgtgagaatttagactttgccactgcaaagaagctcaacatagagggtctgaattgttttcttcaggaccgcattgtcatcaccagcctcaatgaccgtctggtcaggcttattgaactggcccgttgttttgaagaggagaacgagtctcttgaatgtcagattgatgatctagaggagaagctgtatagacgaaaagcttccttcagcaacacctctgctgcagctgagccggaatccggtctggatgcagtggtggagaacctacgcagggagagggatgagattctgaatgacaccgaagaactgcgtaaggagcttgaatgtttgatgaaacactgtgagaacgctacacatcgtcggaccctcctgcagcgagagcagcaaaatgttgctgaggcagtggacggcgtgacagccgggtgcttggcgttgagggagcaggtgtctatctatgagaagcagctggacaacatggaggcacagaaggcattggagagtctcctggagccagttgaagggattacgggggcgctggcagctattaaatatggcagccctgacatcgctccggctttggatgtaaaggagttctactgccagctggctgagagactgaagtttgactgtggcgcgacgtcttctgctgtggtttgcaacggttacaggaaacaactggacaaggaaggagctgtcaagtcaaaagacatcagtgagatgaagatgatgacctacaagctacaaaagaagcttgctgtgcttgagaagtacaacaatgagctggaggaagagttcagtatgaggaacgctgcatacgcggatgagatcgctgagctggagagtactatagatgaaatgcagcaccaggaggccaaactaaaagtgcagatgaaggagcagtgtgaagattacaaggagctgctcagtgagaagatggccagagatatggaaatagctgcatacaggagtctggtggaggaagaggaagagaggctgtccaaaatgtgacgtgaggccagaaaatctcaataactgtatgctccccctggtacgcattaccaaacaaacaagtcttcttgaagatgcaatgccgtgctgcttggatagtatagctaagtaagctaagcttctagtaactctacagtaaataagtcttcactacactgaagcca
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]