GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2025-02-22 14:53:33, GGRNA.v2 : RefSeq release 228 (Jan, 2025)

LOCUS       XM_067886343             549 bp    mRNA    linear   PLN 29-AUG-2024
DEFINITION  Phytophthora ramorum Protein argonaute-4 (KRP23_1681), partial
            mRNA.
ACCESSION   XM_067886343
VERSION     XM_067886343.1
DBLINK      BioProject: PRJNA1149793
            BioSample: SAMN19730089
KEYWORDS    RefSeq.
SOURCE      Phytophthora ramorum (sudden oak death agent)
  ORGANISM  Phytophthora ramorum
            Eukaryota; Sar; Stramenopiles; Oomycota; Peronosporales;
            Peronosporaceae; Phytophthora.
REFERENCE   1  (bases 1 to 549)
  AUTHORS   Carleson,N.C., Press,C.M. and Grunwald,N.J.
  TITLE     High-Quality, Phased Genomes of Phytophthora ramorum Clonal
            Lineages NA1 and EU1
  JOURNAL   Mol Plant Microbe Interact 35 (4), 360-363 (2022)
   PUBMED   35285670
REFERENCE   2  (bases 1 to 549)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (27-AUG-2024) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 549)
  AUTHORS   Carleson,N.C., Press,C.M. and Grunwald,N.J.
  TITLE     Direct Submission
  JOURNAL   Submitted (19-JUL-2021) Horticultural Crops Research Unit, USDA,
            3420 NW Orchard Ave., Corvallis, OR 97330, USA
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. This record is derived from an annotated genomic
            sequence (NW_027150648).
            COMPLETENESS: incomplete on both ends.
FEATURES             Location/Qualifiers
     source          1..549
                     /organism="Phytophthora ramorum"
                     /mol_type="mRNA"
                     /isolate="Pr-102"
                     /host="Quercus agrifolia"
                     /db_xref="taxon:164328"
                     /chromosome="Unknown"
                     /mating_type="A2"
                     /geo_loc_name="USA: California"
                     /collection_date="2004"
                     /genotype="NA1"
     gene            <1..>549
                     /locus_tag="KRP23_1681"
                     /db_xref="GeneID:94222150"
     CDS             1..549
                     /locus_tag="KRP23_1681"
                     /codon_start=1
                     /product="Protein argonaute-4"
                     /protein_id="XP_067749014.1"
                     /db_xref="GeneID:94222150"
                     /translation="
MDAIDFLCETLALRNMSTSVAKYQHSTFSKAIRDVKVNMIHRPGVKRSYRVNGLSRESADNTFFGDDEGQRMSIAQYFQQTYKIRLRYQKLSCLQRNYLPMEVCHVMAGQTCLHNVTDTQVANMIRLTCTPPGDRSSTSSARLTSTRTRSPKASTGCGKAENGGNDGPPAATSCDRVQWRGL"
     misc_feature    1..318
                     /locus_tag="KRP23_1681"
                     /note="PAZ domain, argonaute_like subfamily. Argonaute is
                     part of the RNA-induced silencing complex (RISC), and is
                     an endonuclease that plays a key role in the RNA
                     interference pathway. The PAZ domain has been named after
                     the proteins Piwi,Argonaut, and Zwille; Region:
                     PAZ_argonaute_like; cd02846"
                     /db_xref="CDD:239212"
     misc_feature    order(145..147,187..189,220..222,232..234,289..291,
                     295..297)
                     /locus_tag="KRP23_1681"
                     /note="nucleic acid-binding interface [nucleotide
                     binding]; other site"
                     /db_xref="CDD:239212"
ORIGIN      
atggacgcgatagactttctgtgcgagacgctggcgctcaggaacatgtccacgtctgtggctaagtaccagcactcgaccttcagcaaggccattcgagacgtcaaagtcaacatgatccatcgtccaggggtcaagcgcagctaccgtgtgaacggcttgtcacgtgaaagcgcagataatacgttcttcggggacgacgaagggcagcgcatgtccatcgctcagtacttccagcaaacgtacaaaatccgtctgcgctaccagaagctatcgtgtttgcagaggaattacttgcctatggaggtctgtcacgtcatggcgggtcagacgtgtcttcacaatgtcacggacacgcaggtggccaacatgatccgcctcacgtgcacgcctcccggcgatcgctcgagcacaagctccgcgaggctgacttcaacacggacccgatcccccaaggcgtcgactggatgtggtaaagccgagaatggtggaaacgacgggccgccagctgccacctcctgcgatcgagtacagtggaggggcttgtaa
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]