GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2024-07-23 23:22:10, GGRNA.v2 : RefSeq release 224 (May, 2024)

LOCUS       XM_062740726             440 bp    mRNA    linear   INV 05-FEB-2024
DEFINITION  PREDICTED: Saccostrea cucullata uncharacterized LOC134258183
            (LOC134258183), partial mRNA.
ACCESSION   XM_062740726
VERSION     XM_062740726.1
DBLINK      BioProject: PRJNA1071555
KEYWORDS    RefSeq.
SOURCE      Saccostrea cucullata (small rock oyster)
  ORGANISM  Saccostrea cucullata
            Eukaryota; Metazoa; Spiralia; Lophotrochozoa; Mollusca; Bivalvia;
            Autobranchia; Pteriomorphia; Ostreida; Ostreoidea; Ostreidae;
            Saccostrea.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NW_026941626) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_032062105.1-RS_2024_01
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.2
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 01/31/2024
            ##Genome-Annotation-Data-END##
            COMPLETENESS: incomplete on the 3' end.
FEATURES             Location/Qualifiers
     source          1..440
                     /organism="Saccostrea cucullata"
                     /mol_type="mRNA"
                     /isolate="Sc308-1"
                     /db_xref="taxon:36930"
                     /chromosome="Unknown"
                     /tissue_type="Abductor muscle"
                     /country="Australia: WA, Karratha"
                     /collection_date="2022-03-29"
     gene            1..>440
                     /gene="LOC134258183"
                     /note="uncharacterized LOC134258183; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon."
                     /db_xref="GeneID:134258183"
     CDS             33..>440
                     /gene="LOC134258183"
                     /codon_start=1
                     /product="uncharacterized protein LOC134258183"
                     /protein_id="XP_062596710.1"
                     /db_xref="GeneID:134258183"
                     /translation="
MMQSLLVFVISVASIKTLHGSNGVMYPSSLSTLNEVPNCPRNQHDWEKAAARKDCNQISKSDNKPFVYHCLINEWANATVEVCAPTWFVSGFCAMYSSSDARVIDNFNYDCTHYTPPCPQRYISSEAYKYGVCYDI"
ORIGIN      
tccattaacacaaagtcttggtaaaaaagtaaatgatgcaatctcttcttgtatttgtcatatcagttgcatcaataaaaacactgcatggaagcaatggagttatgtatccatcgtcattgtcaacgcttaatgaagttcccaattgtcctagaaatcaacatgattgggaaaaagctgcagccagaaaggattgcaaccaaattagtaaaagtgacaacaagccctttgtttatcactgtttaataaatgaatgggcaaatgctacagttgaagtatgtgctccaacatggtttgtctcaggattctgtgcaatgtacagttcttccgatgcaagagttattgacaactttaactacgactgcacccattacacccctccttgtccacaacgatacatttcatcagaggcttacaaatatggcgtttgctatgacatt
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]