2025-03-14 18:00:37, GGRNA.v2 : RefSeq release 228 (Jan, 2025)
LOCUS XM_061291210 623 bp mRNA linear VRT 05-DEC-2023 DEFINITION PREDICTED: Syngnathus typhle prefoldin 5 (pfdn5), mRNA. ACCESSION XM_061291210 VERSION XM_061291210.1 DBLINK BioProject: PRJNA1046123 KEYWORDS RefSeq. SOURCE Syngnathus typhle (broad-nosed pipefish) ORGANISM Syngnathus typhle Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Actinopterygii; Neopterygii; Teleostei; Neoteleostei; Acanthomorphata; Syngnathiaria; Syngnathiformes; Syngnathoidei; Syngnathidae; Syngnathus. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_083748) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_033458585.1-RS_2023_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.2 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/02/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..623 /organism="Syngnathus typhle" /mol_type="mRNA" /isolate="RoL2023-S1" /db_xref="taxon:161592" /sex="male" /tissue_type="body" /ecotype="Sweden" /geo_loc_name="Sweden" /collection_date="2022-07-15" /linkage_group="LG11" gene 1..623 /gene="pfdn5" /note="prefoldin 5; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 13 Proteins" /db_xref="GeneID:133162192" CDS 46..501 /gene="pfdn5" /codon_start=1 /product="prefoldin subunit 5" /protein_id="XP_061147194.1" /db_xref="GeneID:133162192" /translation="
MAINLADLSLPQLEGLKSQLDQEVEFLTSSISQLKVVQAKFVEAKDNLNSLNKKNQGKELLVPLTSSMYVPGTLNDVEHVLVDVGTGYYVEKNVADSKAFFKRKLDFLTKQIEKIQPALQEKHAMKQAVIEVMNVKIQQLQQSKQASSTKA"
polyA_site 623 /gene="pfdn5" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN
tgaaccggaagcaatccctgacgtcacactccccaggttcccaacatggcgatcaatcttgcggacctatcgctccctcagcttgagggactgaaaagccaattagaccaggaggtcgagttcctgacgtcctcaataagccagcttaaagtcgtccaggctaaatttgttgaagcaaaagataatttgaattccttaaacaaaaaaaatcaaggcaaggaattactcgtcccactcacaagttctatgtatgtgcctggaacattaaatgacgtggagcatgttttagtcgatgtgggaacaggatattatgttgaaaagaatgtagcagattccaaggcattcttcaaacgaaaactagacttcctgacaaagcaaattgagaaaattcagcccgcccttcaggaaaaacatgccatgaaacaagctgtcattgaagtcatgaatgtgaagatccaacagctacaacagagtaaacaggcttccagcaccaaggcttaatcgtgacaacacttaaatgaatgctttgtgtgtgtgtgaaaaagaactgtaaaatgtcctgcactgacctttatacaatctcttcttgcataatttggaaataaagggttggtgaacattaa
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]