GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2025-03-14 18:00:37, GGRNA.v2 : RefSeq release 228 (Jan, 2025)

LOCUS       XM_061291210             623 bp    mRNA    linear   VRT 05-DEC-2023
DEFINITION  PREDICTED: Syngnathus typhle prefoldin 5 (pfdn5), mRNA.
ACCESSION   XM_061291210
VERSION     XM_061291210.1
DBLINK      BioProject: PRJNA1046123
KEYWORDS    RefSeq.
SOURCE      Syngnathus typhle (broad-nosed pipefish)
  ORGANISM  Syngnathus typhle
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Actinopterygii; Neopterygii; Teleostei; Neoteleostei;
            Acanthomorphata; Syngnathiaria; Syngnathiformes; Syngnathoidei;
            Syngnathidae; Syngnathus.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_083748) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_033458585.1-RS_2023_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.2
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/02/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..623
                     /organism="Syngnathus typhle"
                     /mol_type="mRNA"
                     /isolate="RoL2023-S1"
                     /db_xref="taxon:161592"
                     /sex="male"
                     /tissue_type="body"
                     /ecotype="Sweden"
                     /geo_loc_name="Sweden"
                     /collection_date="2022-07-15"
                     /linkage_group="LG11"
     gene            1..623
                     /gene="pfdn5"
                     /note="prefoldin 5; Derived by automated computational
                     analysis using gene prediction method: Gnomon. Supporting
                     evidence includes similarity to: 13 Proteins"
                     /db_xref="GeneID:133162192"
     CDS             46..501
                     /gene="pfdn5"
                     /codon_start=1
                     /product="prefoldin subunit 5"
                     /protein_id="XP_061147194.1"
                     /db_xref="GeneID:133162192"
                     /translation="
MAINLADLSLPQLEGLKSQLDQEVEFLTSSISQLKVVQAKFVEAKDNLNSLNKKNQGKELLVPLTSSMYVPGTLNDVEHVLVDVGTGYYVEKNVADSKAFFKRKLDFLTKQIEKIQPALQEKHAMKQAVIEVMNVKIQQLQQSKQASSTKA"
     polyA_site      623
                     /gene="pfdn5"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
tgaaccggaagcaatccctgacgtcacactccccaggttcccaacatggcgatcaatcttgcggacctatcgctccctcagcttgagggactgaaaagccaattagaccaggaggtcgagttcctgacgtcctcaataagccagcttaaagtcgtccaggctaaatttgttgaagcaaaagataatttgaattccttaaacaaaaaaaatcaaggcaaggaattactcgtcccactcacaagttctatgtatgtgcctggaacattaaatgacgtggagcatgttttagtcgatgtgggaacaggatattatgttgaaaagaatgtagcagattccaaggcattcttcaaacgaaaactagacttcctgacaaagcaaattgagaaaattcagcccgcccttcaggaaaaacatgccatgaaacaagctgtcattgaagtcatgaatgtgaagatccaacagctacaacagagtaaacaggcttccagcaccaaggcttaatcgtgacaacacttaaatgaatgctttgtgtgtgtgtgaaaaagaactgtaaaatgtcctgcactgacctttatacaatctcttcttgcataatttggaaataaagggttggtgaacattaa
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]