GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2025-11-02 01:58:38, GGRNA.v2 : RefSeq release 232 (Sep, 2025)

LOCUS       XM_057395547             381 bp    mRNA    linear   PLN 13-JUN-2023
DEFINITION  PREDICTED: Beta vulgaris subsp. vulgaris uncharacterized
            mitochondrial protein AtMg00310-like (LOC130591735), mRNA.
ACCESSION   XM_057395547
VERSION     XM_057395547.1
DBLINK      BioProject: PRJNA973951
KEYWORDS    RefSeq; includes ab initio.
SOURCE      Beta vulgaris subsp. vulgaris (sugar beet)
  ORGANISM  Beta vulgaris subsp. vulgaris
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
            Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae;
            Pentapetalae; Caryophyllales; Chenopodiaceae; Betoideae; Beta.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_079207) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_026745355.1-RS_2023_06
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 06/07/2023
            ##Genome-Annotation-Data-END##
            
            ##RefSeq-Attributes-START##
            ab initio :: 100% of CDS bases
            ##RefSeq-Attributes-END##
FEATURES             Location/Qualifiers
     source          1..381
                     /organism="Beta vulgaris subsp. vulgaris"
                     /mol_type="mRNA"
                     /cultivar="EL10"
                     /sub_species="vulgaris"
                     /db_xref="taxon:3555"
                     /chromosome="6"
                     /tissue_type="leaf"
                     /dev_stage="adult"
                     /geo_loc_name="USA"
     gene            1..381
                     /gene="LOC130591735"
                     /note="uncharacterized mitochondrial protein
                     AtMg00310-like; Derived by automated computational
                     analysis using gene prediction method: Gnomon. Supporting
                     evidence includes similarity to: 2 Proteins"
                     /db_xref="GeneID:130591735"
     CDS             1..381
                     /gene="LOC130591735"
                     /codon_start=1
                     /product="uncharacterized mitochondrial protein
                     AtMg00310-like"
                     /protein_id="XP_057251530.1"
                     /db_xref="GeneID:130591735"
                     /translation="
MKEAARVEREIAIHPGKEVLIKLVAQAIPTYMMSVFSLPSGLIDEIHSLLARFWWGSSDTDRKMHWHSWDTLCYPKSMGGLGFRDLHCFNQSLLAKQAWRLCTGDQTLLYRLLQARYFKSSEFLEA"
ORIGIN      
atgaaagaagctgcaagggtggaaagagaaattgctatccaccccgggaaagaggtgcttattaaattagtggcgcaagctattcccacgtatatgatgagtgtattcagccttcctagcggattgattgatgagattcattcgttgctggctcgattttggtgggggtcctctgacactgataggaagatgcattggcatagttgggatacgttgtgctaccccaaatcgatgggcggtcttggctttagggacctacactgcttcaaccaatctcttcttgcaaagcaagcatggcggttatgtacgggggaccagactcttctttatcggctgctgcaagcacgatactttaagtcttcggaatttctggaggcgtga
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]