2024-10-23 02:06:07, GGRNA.v2 : RefSeq release 226 (Sep, 2024)
LOCUS XM_057266820 669 bp mRNA linear PLN 12-JUN-2023 DEFINITION Penicillium waksmanii uncharacterized protein (N7481_007601), partial mRNA. ACCESSION XM_057266820 VERSION XM_057266820.1 DBLINK BioProject: PRJNA973687 BioSample: SAMN30185384 KEYWORDS RefSeq. SOURCE Penicillium waksmanii ORGANISM Penicillium waksmanii Eukaryota; Fungi; Dikarya; Ascomycota; Pezizomycotina; Eurotiomycetes; Eurotiomycetidae; Eurotiales; Aspergillaceae; Penicillium. REFERENCE 1 (bases 1 to 669) AUTHORS Petersen,C., Sorensen,T., Nielsen,M.R., Sondergaard,T.E., Sorensen,J.L., Fitzpatrick,D.A., Frisvad,J.C. and Nielsen,K.L. TITLE Comparative genomic study of the Penicillium genus elucidates a diverse pangenome and 15 lateral gene transfer events JOURNAL IMA Fungus 14 (1), 3 (2023) PUBMED 36726175 REMARK Publication Status: Online-Only REFERENCE 2 (bases 1 to 669) CONSRTM NCBI Genome Project TITLE Direct Submission JOURNAL Submitted (09-JUN-2023) National Center for Biotechnology Information, NIH, Bethesda, MD 20894, USA REFERENCE 3 (bases 1 to 669) AUTHORS Petersen,C. TITLE Direct Submission JOURNAL Submitted (12-JAN-2023) Department of Chemistry and Bioscience, Aalborg University, Fredrik Bajers Vej 7H, Aalborg, Nordjylland 9220, Denmark COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. This record is derived from an annotated genomic sequence (NW_026643253). COMPLETENESS: incomplete on both ends. FEATURES Location/Qualifiers source 1..669 /organism="Penicillium waksmanii" /mol_type="mRNA" /strain="IBT 27052" /culture_collection="IBT:27052" /db_xref="taxon:69791" /chromosome="Unknown" gene <1..>669 /locus_tag="N7481_007601" /db_xref="GeneID:81918601" CDS 1..669 /locus_tag="N7481_007601" /codon_start=1 /product="uncharacterized protein" /protein_id="XP_057121021.1" /db_xref="GeneID:81918601" /translation="
MPSKICHTSSIPNPSQILKNNKDWPKWNLETHQTLKKRNFTRLLKDINKPPPSSDDPTPLQRWNHSQKTACAIVISKLTPTIAKAMHPHKTLETLLQAVNNYTKPTASEALEMLCSLWTRLSTLHSSRHASITDYCAEARDIEMQYRRLGTGISDAILSCAFIAGLPLDWQEWKIRRTQNATVLVPWDDCSSSTFSFENLVLDALEEEVRNLNLFLQHHSRK"
ORIGIN
atgccttccaagatctgccacaccagctccatccccaacccgagccaaatcctcaaaaacaacaaagactggccaaaatggaacctagaaacccaccaaaccctcaaaaagcgcaacttcacccgactcctcaaagatatcaacaaaccaccaccctcatccgatgatccaaccccgctacaaagatggaaccactcccaaaaaaccgcctgcgcaatcgtcatcagcaaactaaccccaacaatcgcaaaagcaatgcacccccataaaaccctcgaaacccttctccaagccgtgaacaactacacaaaacccacagccagcgaagccctcgaaatgctctgctctctttggaccagactttccaccctccattcttcgcgacatgcgagtatcaccgactactgcgccgaagctcgggatattgaaatgcagtatcgccggcttggaacgggaatttctgacgctattctgtcatgcgcgtttattgcgggtcttccgttggattggcaggagtggaagattcgacgaactcagaatgcaacggttttggttccgtgggatgattgttcgagttcgacgttttcgtttgagaatctggtgcttgatgcgttggaagaagaggttcgaaatctcaatctcttcttgcaacaccactcccgcaaataa
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]