ver.2
Home
|
Help
|
Advanced search
Previous release (v1)
2026-01-09 14:29:56, GGRNA.v2 : RefSeq release 232 (Sep, 2025)
LOCUS XM_057266820 669 bp mRNA linear PLN 12-JUN-2023
DEFINITION Penicillium waksmanii uncharacterized protein (N7481_007601),
partial mRNA.
ACCESSION XM_057266820
VERSION XM_057266820.1
DBLINK BioProject: PRJNA973687
BioSample: SAMN30185384
KEYWORDS RefSeq.
SOURCE Penicillium waksmanii
ORGANISM Penicillium waksmanii
Eukaryota; Fungi; Dikarya; Ascomycota; Pezizomycotina;
Eurotiomycetes; Eurotiomycetidae; Eurotiales; Aspergillaceae;
Penicillium.
REFERENCE 1 (bases 1 to 669)
AUTHORS Petersen,C., Sorensen,T., Nielsen,M.R., Sondergaard,T.E.,
Sorensen,J.L., Fitzpatrick,D.A., Frisvad,J.C. and Nielsen,K.L.
TITLE Comparative genomic study of the Penicillium genus elucidates a
diverse pangenome and 15 lateral gene transfer events
JOURNAL IMA Fungus 14 (1), 3 (2023)
PUBMED 36726175
REMARK Publication Status: Online-Only
REFERENCE 2 (bases 1 to 669)
CONSRTM NCBI Genome Project
TITLE Direct Submission
JOURNAL Submitted (09-JUN-2023) National Center for Biotechnology
Information, NIH, Bethesda, MD 20894, USA
REFERENCE 3 (bases 1 to 669)
AUTHORS Petersen,C.
TITLE Direct Submission
JOURNAL Submitted (12-JAN-2023) Department of Chemistry and Bioscience,
Aalborg University, Fredrik Bajers Vej 7H, Aalborg, Nordjylland
9220, Denmark
COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final
NCBI review. This record is derived from an annotated genomic
sequence (NW_026643253).
COMPLETENESS: incomplete on both ends.
FEATURES Location/Qualifiers
source 1..669
/organism="Penicillium waksmanii"
/mol_type="mRNA"
/strain="IBT 27052"
/culture_collection="IBT:27052"
/db_xref="taxon:69791"
/chromosome="Unknown"
gene <1..>669
/locus_tag="N7481_007601"
/db_xref="GeneID:81918601"
CDS 1..669
/locus_tag="N7481_007601"
/codon_start=1
/product="uncharacterized protein"
/protein_id="XP_057121021.1"
/db_xref="GeneID:81918601"
/translation="
MPSKICHTSSIPNPSQILKNNKDWPKWNLETHQTLKKRNFTRLLKDINKPPPSSDDPTPLQRWNHSQKTACAIVISKLTPTIAKAMHPHKTLETLLQAVNNYTKPTASEALEMLCSLWTRLSTLHSSRHASITDYCAEARDIEMQYRRLGTGISDAILSCAFIAGLPLDWQEWKIRRTQNATVLVPWDDCSSSTFSFENLVLDALEEEVRNLNLFLQHHSRK"
ORIGIN
atgccttccaagatctgccacaccagctccatccccaacccgagccaaatcctcaaaaacaacaaagactggccaaaatggaacctagaaacccaccaaaccctcaaaaagcgcaacttcacccgactcctcaaagatatcaacaaaccaccaccctcatccgatgatccaaccccgctacaaagatggaaccactcccaaaaaaccgcctgcgcaatcgtcatcagcaaactaaccccaacaatcgcaaaagcaatgcacccccataaaaccctcgaaacccttctccaagccgtgaacaactacacaaaacccacagccagcgaagccctcgaaatgctctgctctctttggaccagactttccaccctccattcttcgcgacatgcgagtatcaccgactactgcgccgaagctcgggatattgaaatgcagtatcgccggcttggaacgggaatttctgacgctattctgtcatgcgcgtttattgcgggtcttccgttggattggcaggagtggaagattcgacgaactcagaatgcaacggttttggttccgtgggatgattgttcgagttcgacgttttcgtttgagaatctggtgcttgatgcgttggaagaagaggttcgaaatctcaatctcttcttgcaacaccactcccgcaaataa
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]