GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2025-06-12 16:03:03, GGRNA.v2 : RefSeq release 229 (Mar, 2025)

LOCUS       XM_057006913             809 bp    mRNA    linear   PLN 08-JUN-2023
DEFINITION  PREDICTED: Raphanus sativus HVA22-like protein d (LOC130510523),
            mRNA.
ACCESSION   XM_057006913
VERSION     XM_057006913.1
DBLINK      BioProject: PRJNA344915
KEYWORDS    RefSeq.
SOURCE      Raphanus sativus (radish)
  ORGANISM  Raphanus sativus
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
            Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae;
            Pentapetalae; rosids; malvids; Brassicales; Brassicaceae;
            Brassiceae; Raphanus.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_079514) annotated using gene prediction method: Gnomon,
            supported by EST evidence.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_000801105.2-RS_2023_06
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 06/01/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..809
                     /organism="Raphanus sativus"
                     /mol_type="mRNA"
                     /cultivar="WK10039"
                     /db_xref="taxon:3726"
                     /chromosome="4"
                     /tissue_type="leaf"
     gene            1..809
                     /gene="LOC130510523"
                     /note="HVA22-like protein d; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 2
                     ESTs, 13 Proteins"
                     /db_xref="GeneID:130510523"
     CDS             94..501
                     /gene="LOC130510523"
                     /codon_start=1
                     /product="HVA22-like protein d"
                     /protein_id="XP_056862893.1"
                     /db_xref="GeneID:130510523"
                     /translation="
MTKFWTLLTALHTGAGPVVMLVYPLYASVVAMETATKVDDEQWLSYWIIYSFLTLTELILQSLLEWIPIWYSVKLVFVAWLVLPQFHGAAFIYNSLVREQFKKHGVFSHQQSKPTKPKILNSIFPHREGHEAHSH"
     misc_feature    163..387
                     /gene="LOC130510523"
                     /note="TB2/DP1, HVA22 family; Region: TB2_DP1_HVA22;
                     pfam03134"
                     /db_xref="CDD:460820"
     polyA_site      809
                     /gene="LOC130510523"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
agcctcaacaatttcgcagagttgtctctctgtttctctcactcttccagattttagtagcttctgaattttattttattttataagagaaaaatgaccaagttctggactttactcactgctcttcatacaggcgctgggcctgtggtgatgttagtatatccactgtacgcatcggtggtagctatggagaccgcaacgaaagtagacgatgaacagtggctatcctactggatcatatactcgttcctgacgctcacggagctgattctacaatctcttcttgagtggattcctatttggtactcggtcaaacttgtgttcgtcgcttggttggttctgcctcagttccatggagctgctttcatctacaacagtttggtgagagaacagttcaagaaacacggcgtcttctctcaccaacagtcaaagcccaccaaacccaagatccttaactccattttcccccaccgggagggacacgaggctcactctcactgacacaagaaaaaaaaaaggaagaaagcttgactggtattgtaatggagttggtagtggtcccatcttgactaatcttacgttttacttttgttttgtttatacaaaaaaaaaagaatgtggtttggggaaagatatgatcatatatatgatgatgattgatgactgatgagttgtgtggtcggaagtgacttgttgttgttgttgttgttgttgtatttccttagtttccacgcatcttttccatctgggaacacaaatgttacgctattgtttgttcaaatcgaatttccaacttttgtgaggataaa
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]