2024-04-29 05:27:36, GGRNA.v2 : RefSeq release 222 (Jan, 2024)
LOCUS XM_056109440 678 bp mRNA linear MAM 09-OCT-2023 DEFINITION PREDICTED: Sorex fumeus claudin 8 (CLDN8), mRNA. ACCESSION XM_056109440 VERSION XM_056109440.1 DBLINK BioProject: PRJNA972655 KEYWORDS RefSeq. SOURCE Sorex fumeus (smoky shrew) ORGANISM Sorex fumeus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Laurasiatheria; Eulipotyphla; Soricidae; Soricinae; Sorex. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NW_026606322) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Updated annotation Annotation Name :: GCF_029834395.1-RS_2023_10 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.2 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 10/04/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..678 /organism="Sorex fumeus" /mol_type="mRNA" /db_xref="taxon:62283" /chromosome="Unknown" gene 1..678 /gene="CLDN8" /note="claudin 8; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 11 Proteins" /db_xref="GeneID:130018656" CDS 1..678 /gene="CLDN8" /codon_start=1 /product="claudin-8" /protein_id="XP_055965415.1" /db_xref="GeneID:130018656" /translation="
MASYAIQMAGLVLGGVGMVGTIAITIMPQWRVSAFIGSNIVVFETLWEGLWMNCMRHANIRMQCKVYDSLLALPSDLQASRGLMCAACVLAFLAFMTAVLGMKCTRCTGEDQRVKGYILLTAGIVFIVTGVVVLIPVSWVANSIIRDFYNPIVDAAQKRELGEALYLGWTTALVLIAGGALFCCVSCSNGKSGSYRYSIPSHRTTPKSYHTGKKSPSEYSKSQYV"
misc_feature 13..546 /gene="CLDN8" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:451326" ORIGIN
atggcaagctatgccatccaaatggccgggctggtgcttggtggcgttggcatggtgggcaccatcgctatcacgatcatgcctcagtggagagtgtctgccttcatcggaagcaacatcgtggtctttgaaaccctgtgggaaggactgtggatgaactgcatgaggcatgcgaacatcagaatgcagtgcaaagtctacgattcgctgctggctctcccttcggacctgcaggcatccagaggcttgatgtgtgcggcatgcgtgctcgcctttttggctttcatgacggccgtcctgggcatgaaatgcactaggtgcactggggaggaccagagagtgaagggctacatcctgctcacggccggaatcgtcttcatcgtcactggcgtcgtggtgctcatccctgtgagctgggtggccaattccatcatcagggatttctacaaccccatagtggatgctgctcaaaaacgtgagctgggagaagccctctacctaggctggaccacagccctggtgctcatcgcggggggagcactgttctgttgtgtttcttgttccaatggaaagagtggcagctaccgctactccatcccgtcccatcgcacaacccccaaaagctatcacacgggaaagaaatcaccgagcgagtattcgaaaagtcagtatgtgtag
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]