ver.2
Home
|
Help
|
Advanced search
Previous release (v1)
2025-10-30 13:24:25, GGRNA.v2 : RefSeq release 232 (Sep, 2025)
LOCUS XM_054953827 565 bp mRNA linear PLN 05-APR-2023
DEFINITION PREDICTED: Prosopis cineraria uncharacterized LOC129311497
(LOC129311497), mRNA.
ACCESSION XM_054953827
VERSION XM_054953827.1
DBLINK BioProject: PRJNA948452
KEYWORDS RefSeq; includes ab initio.
SOURCE Prosopis cineraria
ORGANISM Prosopis cineraria
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae;
Pentapetalae; rosids; fabids; Fabales; Fabaceae; Caesalpinioideae;
mimosoid clade; Mimoseae; Prosopis.
COMMENT MODEL REFSEQ: This record is predicted by automated computational
analysis. This record is derived from a genomic sequence
(NW_026555336) annotated using gene prediction method: Gnomon.
Also see:
Documentation of NCBI's Annotation Process
##Genome-Annotation-Data-START##
Annotation Provider :: NCBI RefSeq
Annotation Status :: Full annotation
Annotation Name :: GCF_029017545.1-RS_2023_03
Annotation Pipeline :: NCBI eukaryotic genome annotation
pipeline
Annotation Software Version :: 10.1
Annotation Method :: Gnomon; cmsearch; tRNAscan-SE
Features Annotated :: Gene; mRNA; CDS; ncRNA
Annotation Date :: 03/29/2023
##Genome-Annotation-Data-END##
##RefSeq-Attributes-START##
ab initio :: 1% of CDS bases
##RefSeq-Attributes-END##
FEATURES Location/Qualifiers
source 1..565
/organism="Prosopis cineraria"
/mol_type="mRNA"
/cultivar="Desert tree"
/isolate="PC_DT_omini"
/db_xref="taxon:364024"
/chromosome="Unknown"
/tissue_type="leaf"
/geo_loc_name="United Arab Emirates: Abu Dhabi"
gene 1..565
/gene="LOC129311497"
/note="uncharacterized LOC129311497; Derived by automated
computational analysis using gene prediction method:
Gnomon."
/db_xref="GeneID:129311497"
CDS 80..565
/gene="LOC129311497"
/codon_start=1
/product="uncharacterized protein LOC129311497"
/protein_id="XP_054809802.1"
/db_xref="GeneID:129311497"
/translation="
MKRAKPKSHSKTSNHSHNSSPSLKSFIEPPPDFFPSKHEFLRLIVVLAFASAVAWTCNLFLTSFINPSTKPFCDSNVDFPDSFSDDCEPCPSNGACYDGKLECLQGYRKHGKLCVEDGDINKSAKKISDRVKCSLCEDYAQYLCYGVGSVWVQEDEIWKTF"
misc_feature 314..>511
/gene="LOC129311497"
/note="Man1-Src1p-C-terminal domain; Region: MSC;
pfam09402"
/db_xref="CDD:430586"
ORIGIN
aacagcagcaaacaagggtgccgtaaaaggcggtctgagcatcccgctcggccggacacatcactctgatctcttccaaatgaagcgcgcaaaacccaagtcccattccaaaacttcaaatcattctcacaattcttctccttctttgaaatcgttcatagaaccccctcctgatttctttccctcgaagcacgagttcctcaggctcatcgtcgtccttgcattcgcatcagcagttgcttggacatgcaatctcttcttgacatcttttattaatccctccaccaagcccttttgcgatagcaacgtagactttccggattcattttccgatgattgtgaaccttgtccaagtaatggagcatgttacgatggcaaattggaatgtctccagggctaccgaaagcatgggaagttgtgtgtagaagatggagatattaataaatcagctaaaaaaatttcggacagagtaaaatgtagcctatgtgaagattatgctcagtatttgtgctatggagtcggatcagtttgggttcaagaggatgaaatatggaaaactttttga
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]