GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2024-07-15 04:30:01, GGRNA.v2 : RefSeq release 224 (May, 2024)

LOCUS       XM_048891361            4451 bp    mRNA    linear   INV 18-MAY-2023
DEFINITION  PREDICTED: Ostrea edulis metallo-beta-lactamase domain-containing
            protein 1-like (LOC125659624), transcript variant X3, mRNA.
ACCESSION   XM_048891361
VERSION     XM_048891361.2
DBLINK      BioProject: PRJNA970818
KEYWORDS    RefSeq.
SOURCE      Ostrea edulis
  ORGANISM  Ostrea edulis
            Eukaryota; Metazoa; Spiralia; Lophotrochozoa; Mollusca; Bivalvia;
            Autobranchia; Pteriomorphia; Ostreida; Ostreoidea; Ostreidae;
            Ostrea.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_079172) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On May 18, 2023 this sequence version replaced XM_048891361.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_947568905.1-RS_2023_05
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 05/10/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..4451
                     /organism="Ostrea edulis"
                     /mol_type="mRNA"
                     /db_xref="taxon:37623"
                     /chromosome="9"
     gene            1..4451
                     /gene="LOC125659624"
                     /note="metallo-beta-lactamase domain-containing protein
                     1-like; Derived by automated computational analysis using
                     gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 86 long SRA reads, 5 Proteins"
                     /db_xref="GeneID:125659624"
     CDS             122..820
                     /gene="LOC125659624"
                     /codon_start=1
                     /product="metallo-beta-lactamase domain-containing protein
                     1-like"
                     /protein_id="XP_048747318.1"
                     /db_xref="GeneID:125659624"
                     /translation="
MPYEVIVLKEGYSKAEGPGQQRACGSISLIKGPKNIIVDTGNPWDRDNILNGLKQNGLSPENIQYCVCTHGHSDHVGNLNLFCNAVHILSYDICIGDQYQMHDFKMGIPYEIDDDVEVVPTPGHTGTDISVIVSNTDLGTVAVTGDLFECLEDLEEPSLWQDNSENPEIQEQQRIEVLRKADYIVPGHGKMFKVPDEYKRSSMKVVMFREEVYEVGGQKTTLCEYVEIEDSQ"
     misc_feature    131..700
                     /gene="LOC125659624"
                     /note="uncharacterized human metallo-beta-lactamase
                     domain-containing protein 1 and related proteins; MBL-fold
                     metallo hydrolase domain; Region: MBLAC1-like_MBL-fold;
                     cd07711"
                     /db_xref="CDD:293797"
     misc_feature    order(329..331,335..337,341..346,491..496,557..559,
                     683..685)
                     /gene="LOC125659624"
                     /note="active site"
                     /db_xref="CDD:293797"
     polyA_site      4451
                     /gene="LOC125659624"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
ctaaaacccgtcaccccttatacccatacttatcagttagaataaacgaatacaatagacccgaatttaaatgatatataatacgaattgcaacccctttgagccttagcgtgacaacaccatgccctatgaagtaattgttttaaaagaaggctacagtaaagcagaaggcccaggtcaacaaagggcatgtggaagcattagtttgattaaagggcctaaaaacatcattgttgacactggaaacccttgggacagagacaacattctgaatggtcttaaacagaatggactttctccagaaaatatacaatattgtgtgtgtactcatggccattccgatcatgttggaaacctgaacctcttctgtaatgctgttcacattctgtcctatgatatatgtattggggatcaataccaaatgcacgatttcaaaatgggaattccttatgagatagatgatgatgtggaggtggttcccacccccggacacacaggtacggacatctccgttattgtcagcaacacggatctaggaactgtggcagtaacaggtgatttatttgaatgcttggaggacctcgaagagcccagtctttggcaggacaacagtgaaaatcctgaaattcaagaacagcaaaggatagaggttctacgcaaagctgactacatcgttcctggacatgggaaaatgttcaaggttcctgatgagtacaaaagatcgtccatgaaggtagtgatgtttcgtgaagaagtttacgaagttgggggccaaaaaaccactctctgtgaatatgtggagatcgaagacagccagtaattggacatttgatatggaagttaagatttctacatcctctgttgtttattacacattcctttatacaatagtactattatttagaatgtgatagtttcatcaatttttgtgggtatcaaattttgcagatttgtcaacaatatcatggaaagctaccctatgctttctttttgagcaaaagttgtacatgtgctttcaattgatgatctcttgatttcctgatctggtacatctatagatagattaccataggattataatattcctcttttacttatattccaatatttcaattgtgttatattacatccttaaacttacatttgtctgaatgtgtacacttgtctgaatgtgtacacatgtctgaatgtgtacacttgtctgaatgtacacatgtctgaatgtgtaattaaggaggtatgttacaccagagaaatttgatatggattaaaagtgcaggatatgtacatgtatatacaacaatattttgaaattgaaaactttcaaatttacagttcagcagtcaacatgctaacctactgagctattcagcttaggcaatgaatttagaaatgaattgacaaatattgctaatatttatattttcatccatgttttaaagggacatggacacaatttaagctgaaaattttaaaatttttatttttccatttttaatgtttagaatgcttaactaaggtacagtatttctaatggtcagcaaaaatttgaacgtcagttgtcgaggtacatgggagatacagagctcaaaattctgttatgcatgtaaacaaggctcgtgccatgtttttgtttacatagatgtaggttaaatatactagtaaaagtttcgtttaaagcaaattttttcaatttacaagtttattctgaacagaattgaatagtttctagtgtttggcatgcacttctcattttgttttaaacatgctattttctattaagcaatctatatgtaaacaaacacatggcacgagccttgtttacataacaaagaattgtgagtgctgtatctcacttataattcaacaactgcatgagtggcatagctaggtttgaaatatttgtaagcagggggtctggggggctgccgccccccaagaagccgaggacaattttcgtaatatgtaacaaaaatttaacgaaaatatttgtaagcacgtgcatccagtgctacagtgtagctacgccactgaactgatatattcaaattttgtttgaacattagattttttaaagaaaaaagatattctgaattattaaaacttttttgcattggaatttatagatcagctgtgttaattaaattggctatgtcccttataatgtgtactattcaaagacgaaaataatacaatggtttaattcaaaagtttcttgatccacatgcctgcatgaaattgtccaatgtctgcataaaaggaatgttgtctttattttttaaccattgcacgagtaacaaatttgattcattaggtgttttatagatacaactcttctttattacatatttaaatgcagagtttgaaaccaatgtgttgttgttatgagattcctcattttttagctcttctgagccaaaggctcaaagagcctaatgctatggccatttgtgcggtgtgcgtaaactttttagaaaaagggctataactcaagaaccccttggccaattttttttcaaatttgttacagggtatcattggcccaagggctttcatacatactaaatagagggatgtgaccctttaacaaggggagataatcaggaaaatacaaacaaaagtagtggttgctaaaaaatcttcttctcaagaaccacagggcagattatcaccaaacttacacataaggatgaggatatgttgtagattaaaaattgttcaaggcattaccctggggcaaagggcgtggtctcaaggtcacttcaaagttgacctaaattaaaaaaatttttaaattccttaaatcttagatattttagtcattataaggactaggatcatcaaattttgatagttgatgcatcttaggaccttgtgtcaagttgtctcaaaagtaggtcacggtgacctactttttgaattttgcaggtatttattttaaaattaattttgatgcatatcttggacactttgaagcctatgatcatcaaaacttgtcagttggtggatcatgggaccttgaaatgtgtcaactgaaaaataggtcaccgtgacctactttctgaattttatggcttatcatttatagatatattttaagttgttatttcaaatactgagaggtttagaatcatcaaatcttgtaagttgatgcatcttgaggccttgaaacatatttataaaaaagtaggtcacagtgacctattttttgaattttgcagatattcaaatttcacattttcaattttagatgcatattttgggcactgtaaaacctaggatcatcaaactttgtcagttgatgcgtcttcagtcttcggtttgtgtcgaccaaaaagtaggtcaccgtgacctacttatggtatttgacagctaaattactatatttcagacactatttgaactacaatcatcaaactttgtcagttgatgtatcttgagtctacggagtgtgtcgaccaaaaagtaggtcaccttgacctacttttgaaatttgacggctatatttatatatttcagatactatttgatctacagtcatcaaactttgtcagttgatgggtcttgcatgttcgaagggtttcgaccaaaaagtaggtcaacttgacctgcttttggaattggacacctatatttatatatttcagatactatttgacctacagtcatcaaactttgtcagttgatgcgtcttgcatgtccaaagggtgttgaccaaaaagtaggtcaccctgacctacttttggaattggacggctatatttatataattcagatactatttgacctacagtcatcaaactttgtcagttgttgggtcttacatgtttgaagggtgttgatgaaaaagtaggtcaccttgacctactttttgaatttgacggctatatttatatatttcagatactatttgacctacagtcatcaaactttgtcagttgatgggtcttgcatgttcggagttcgctgaccaaaaagtaggtcaccatgacctacgattggaatttgacagctatatttcaatattcagatactaattggcttaagatcattaaactttgtcagttgatatttcttgggttctcaaaatgtgtaaaccaaaaagtaggtcacattgacctactttttttgaattcttaggatttaactaaagatttagaatactaagaggctaagaatagaaatggtggggttgtacaatttatcagaagagcgattctaggcccttgggcctcttgttctgtatcacatgcacattttatgttgtatttcctggtatcactagttttttcttgctacacataccgggtgatgattggatgtgtttttgacttttgaaaatttaaccttctaattttgcacttttgttgcatgtcaaccaaggtgaaccatttttaacactgtgtatgtacattgtacaatgtatgtgtaataaatacaaactcagtaaa
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]