GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2024-07-15 04:31:34, GGRNA.v2 : RefSeq release 224 (May, 2024)

LOCUS       XM_048880160            6829 bp    mRNA    linear   INV 18-MAY-2023
DEFINITION  PREDICTED: Ostrea edulis carboxypeptidase A4-like (LOC125651525),
            transcript variant X2, mRNA.
ACCESSION   XM_048880160
VERSION     XM_048880160.2
DBLINK      BioProject: PRJNA970818
KEYWORDS    RefSeq.
SOURCE      Ostrea edulis
  ORGANISM  Ostrea edulis
            Eukaryota; Metazoa; Spiralia; Lophotrochozoa; Mollusca; Bivalvia;
            Autobranchia; Pteriomorphia; Ostreida; Ostreoidea; Ostreidae;
            Ostrea.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_079168) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On May 18, 2023 this sequence version replaced XM_048880160.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_947568905.1-RS_2023_05
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 05/10/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..6829
                     /organism="Ostrea edulis"
                     /mol_type="mRNA"
                     /db_xref="taxon:37623"
                     /chromosome="5"
     gene            1..6829
                     /gene="LOC125651525"
                     /note="carboxypeptidase A4-like; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 47
                     long SRA reads, 2 Proteins"
                     /db_xref="GeneID:125651525"
     CDS             216..1052
                     /gene="LOC125651525"
                     /codon_start=1
                     /product="carboxypeptidase A5-like isoform X2"
                     /protein_id="XP_048736117.2"
                     /db_xref="GeneID:125651525"
                     /translation="
MVLWNGNAVSTTQDKDGRHFVEQTQNYCWRGTSTGVDLDRNFGWEFGGKGSSSDPNDEEYRGEEAFSEPESKVFQDISADIAFDAFFSFHSGINHIYIPYSDTKSLQLKREPDNVQEMLSLASRLSRCSRYNYRYGTSHHLINYTADGTIFDYMAGIKKIPFSFTIELWGKQHHRPSCFDLFNPENRKLKEVVKSLHPLYINIIMYLSEWKSRNHQDLTNPNAEHPSLVLGYMLLGITIAVSLMVCLHRKWRNCPQLYHHHRIVSLKTLSSSFSAKNL"
     misc_feature    <261..767
                     /gene="LOC125651525"
                     /note="M14 family of metallocarboxypeptidases and related
                     proteins; Region: Peptidase_M14_like; cl11393"
                     /db_xref="CDD:472171"
     polyA_site      6829
                     /gene="LOC125651525"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
caaacccggaacagaccacgattaacgttagcattcgatccaggttccttcagataatattcacaccagcttatggtaaacatgtcagatctgacaatcgacgcgatgacataactgcgataacaatcacacagtgccacttcattctgacattgtatttgcaagaaaatcttcgtttctcagtgaatattaaatatggccatgattgtgtaggaatggtattatggaatggcaacgctgtatccacgacccaggataaagatggacgacattttgtggaacaaactcagaattactgctggcgaggtaccagtacaggagtggaccttgaccgaaactttgggtgggagtttggtggcaaaggaagttcaagtgaccctaatgatgaagaataccgaggagaggaagcattctcagagccagagagtaaagtattccaggacatttctgcagacatcgcatttgatgctttcttttcttttcactcaggaatcaatcatatttacattccatattcagatacaaaatcgctgcagctaaaaagagaacctgacaatgtccaggagatgctaagtttggcctcacgtttgtcccgctgcagtcggtacaattaccgatacgggacctcccatcacctcatcaattatactgcagatggaacaatatttgactacatggcaggaatcaaaaagatacccttctcctttactattgagctgtggggaaaacagcaccaccgccccagctgttttgacttgtttaatccagaaaatagaaaactcaaggaggttgttaaatccctacatccactttacatcaacattattatgtacctctcagaatggaaatccagaaatcaccaggatttgaccaatcctaacgcagaacatccgtctctagtactgggctacatgttgttagggatcaccattgctgtctccttaatggtgtgccttcacaggaaatggagaaactgtccacagctttaccatcatcatagaatagtttccctgaaaaccctgagttcatcattctctgcaaagaatttgtgattttatgatgtaatgttattcagttttcactgtttttcagggaggtaactcttccatatccacaaatccctacaataacaagaaccctcacattgtgtttaaggaggtactctacatcttcataatggctgactttcttttaaaacatggatgaaaatatttatatcagcaacatttgtctattcatttaaaaaaaacattgcccagctgagtagctcagtaggttagcacatcgactactgaactgtagatcgcaggttccagtccagcaggggttttaaatttttttcagattgctttactactaaaactgcattttttgactagatagagttaatttgaaagttttcaatttcaaaatattgttgcacaaatcctccacatttatgtaaattttatggtttttatctgactacgatgatgagtcttgataagtcactattcgctattcagtatcttggctgtttaagggttgtcactcctcaaacttttgatacagttcggacatgccttctagaaaataaacacaatattttgaatagtatagctacattcagtgaccataacttaacttaataccatttcaaaccaaaaaactggaatacaatgctatgtttcatagcagaaggttgttttaaaagaaaaacctcaaagtctgctttaaacatgaaaattgcttttatttttaaactgatagcacacaatcaagcgagtcactgtcgtcatattagtgacacagtattatatttgattgaagtattgatttatactagcaaatatcattagtcccctactggcagagacaaaggggactgttagtttgcactctgtccgtccaaccgtctgtcacaacttagttttcgggatctctattcattatgctttgatttaggaagctgaaatttgacatgtggtttactactgtatgtttacagatcagcttagggttcttcaccattgagtgatttttacaagatttatgggactttgtgccaagtaagtgtttttctgactcctccactatgctttaacttaggaatttgaaatttgatatgtggttatcaaatgagtagatacatattaggttttatttccgttacagctgaattaattaataattattctaacaaaaattgtaaaatttagtctcatggttggctgaattaattcttgcactctgcctagttctctgtattttttcatgaagacatttataatccacttaatctgattcgccgcttccttatgacaagaggtcaaaattacgatgtttttctggtattaaaatatcatatctgatccaaaaatatccaaatatagattttttaatttttgtttaaacacatgagatctagacatcatgtgccaacagcaatgcaggtagaaagttgtgaattttgaagatgctaggtagaaatcaaaatgctgatctttatatgcttcattgtacagcgtacaatgtactggaagatgacccagtgtggttgttcctaacaatagaactcgaggattatgatatgaatgaagagttgtttatacatgtacgatgatagagacatctttgtttgccgatgattcctgacatgttttgattatgaaaatcaaaggaagtgcaaaaggtgatacaattgaaatttcaaggggaccgcacacagaatattatgcaaataacttgacttgggacatgtgttgctatgaaatcaatctgattaaaatacaggtctctcaaatagcactgtgcactatttatatgaattgtatcagattgtatgaaatacttatagaatacttgttttaaaataatttcagtttatatttaaacattaaatttcagcacaaaataaacaattctatccaaaaataacatctttgataccagtttaaaatgtaggctatttcaaaactaaaaattgcattttggaaaaaaaatgttattctttaaaattagtgcaaacaggtcaaaagactataagatattgataaattttcagaattgaatgtacatactgggcagagaagagctacatgtacctaattttcatgcagttcgttaattagcattacttattttacattacttttatgaagactgttaaaatttaagtgcaaaaaaggtgaaaataaatcaatatctcaacctcactagtaagcacactgtcttcccatttttagtttgtatttactgtattgatgtcagaaatatactttgcacaagaattacaatgaggagtgacctcccctttaaccggcccaagtctcatacacaagaacagcacataacaggttttttttttaaacaaaagtgtttgagaaacaatattctgtactgatgtatatcaatttacaattggactacatatacaattgtatatatatttattacatggaagtcaagacatacaaaaacatgatgattatacacataaagtgacaatttcctgtgaaaggacccaaatacattgttaccatgattacttccttttttgaatgttttgtatagaccggtatactcactgggtttttttttcttctctcgttttttatatacaagtatacacttttgcaacatttttaatgtaatatttacatgtactaaaatacaaggatcatttcttattattgaagtcttgaaacatttctcaaaacaaaaaaaaaacaaaaaaaacctcactttctctgccatatcaagtatttgacactttcaacaaagtaaaaatatatctagtgtgtgttgaaaagatacttgactgtaggaaagtctcttggatttccatgcatgagtgggtagaaaacttctgacaggaattgattagggttggtatgtttgttaaagggaaaatatctcagtcacactccattgatacccatggggagactttctgtgagctggctataccttcgtctatagatttccgaagattgcttgatagttcgaccagtaactagtgacacaaattgaatctgtgaacaagaatgtgttagtgaacaaagtagatttacagttatttatttgaacatttatttattgcatagcttttgccaagctatctgagacattttaaaatatgtacattgtgattggtccatagtgatattgtccaataatacatgtattcattattattggttaatgttatacaatatatacatgtattctttatcattagtctatattatacaaaatatacacatatttatatccttggtccataatgtatccttttcaggttaacttaatttaccatgactttgatacatgttatattgaatgcatatatttatagtagaattttgaatcattcatagactaattctctcgaggttgcacctcatgatactgctataaaataatatatgtattgttaaagttacagtccctccttgatatatacttctttattatatacccatcaatgtttcgtttttcgatactgtggatttcacggtttcccggatcaccacacagtggttttctgattccgtatcagtatcctctgaaactgatgatgtcacaatgactcacaatgcatcaacgcaatgtcatttgtggaaaatgttgaccgtatcacaaacaaaactgcgtgcacaaaatataatttcatggtagtctgtgtttttagctcttctgagccaaaggctcaaagagctaatgctatggccatttgtgcggtgtgcgtaaactttttagaaaaagggctataactcaagaaccccttggccaatttttttcaaatttgttacagggtatcattggcccaagggctttcatacatactaaataaagggatgtgaccctttaacaaggggagataatcaggaaaatacaaacaaaagtagtggttgctaaaaaatcttcttctcaagaaccacagggcagattatcaccaaacttacacgtaaggatgaggatatgttgtagattaaaaattgttcaaggcattaccctggggcaaagggcatggtctcaaggtcactttaaagttgacctaaattaaaaaaaattttaaattccttaaatcttagatattttagtcattataaggactaggatcatcaaattttgacagttgatgcatcttaggaccttgtgtcaagttgtctcaaaagtaggtcacggtgacctactttttgaattttgcaggtatttattttaaaattaattttgatgcatatcttggacactttgaagcctatgatcatcaaaacttgtcagttggtggatcatgggactttgaaatgcgtcaactgaaaaataggtcaccgtgacctactttctgaattttatggcttatcatttatagatatattttaagttgttatttcaaataccgagaggtttagaatcatcaaatcttgtaagttgatgcatcttgaggccttgaaacatatttataaaaaagtaggtcacagtgacctactttttgaattttgcagatattcaaatttcacattttcaattttagatgcatattttgggcactgtaaaacctaggatcatcaaactttgtcagttgatgcgtcttcagccttcggtttgtgtcgaccaaaaagtaggtcaccgtgacctacttttggtatttgacagctaaattactatatttcagacactatttgacctacaatcatcaaactttgtcagttgatgcatcttgagtcttcggagtgtatcgaccaaaaagtaggtcactgtgacctacttttggcatttgacagttatatttatatatttcagtcactaattgacctacaatcatcaaaccttgacagttgatgcatcttgagtcaatggagtgtgtcgaccaaaaagtaggtcaccttgacctacttttggaatttgacggctatatttatatatttcaaatactatttgacctacagtcatcaaactttgtcagttgatgggtcttgcatgttcgaagggtttcgaccaaaaagtaggtcaacttgacctacttttggaattggacacctatatttatatatttcagatactatttgacctacagtcatcaaactttgtcagttgatgtgtcttgcatgttcaaagggtgttgaccaaaaagtaggtcaccttgacctacttttggaattggacggctatatttatatatttcagatactatttgacctacagtcatcaaactttgtcagttgatgggtcttgcatgttcggagttcgctgaccagaaagtaggtcaccatgacctacgattggaatttgacagctatatttcaatattcagatactaattggcttaaaatcatcaaactttgtcagttgatatttcttgggttctcaaaatgtgtaaaccaaaaagtaggtcacactgacctacttttttttaattcttaggatttaactaaagatttagaatactaagaggctaagaatagaaatggtggggttgtacaatttatcagaagagcgattctaggcccttgggcctcttgtttataatttggattacatttattatcttataaatgtggatttaaaatgcataagggggtagatctatataataaatatatcattactacagtaacttgatccgaagagttggatcacgtcgagttgacaggcgcagatcatcagatcaaactcgatgcttcgagtcttgtgtgatctgatgatccgcgctggtgaccaactcgacgtgatccgactcttcggatcaagttactgtagtaatatatagttatcgtacatgttgtaattgttaataaaatactgtttaccaatgcaaattcccaaaaataaatcattggatagataa
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]