GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2024-07-15 05:40:48, GGRNA.v2 : RefSeq release 224 (May, 2024)

LOCUS       XM_048275127             560 bp    mRNA    linear   PLN 17-MAY-2022
DEFINITION  PREDICTED: Rhodamnia argentea U-box domain-containing protein
            7-like (LOC115752846), mRNA.
ACCESSION   XM_048275127
VERSION     XM_048275127.1
DBLINK      BioProject: PRJNA836871
KEYWORDS    RefSeq.
SOURCE      Rhodamnia argentea
  ORGANISM  Rhodamnia argentea
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
            Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae;
            Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae;
            Myrteae; Australasian group; Rhodamnia.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_063150) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Full annotation
            Annotation Name             :: Rhodamnia argentea Annotation
                                           Release 101
            Annotation Version          :: 101
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 9.0
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..560
                     /organism="Rhodamnia argentea"
                     /mol_type="mRNA"
                     /isolate="NSW1041297"
                     /db_xref="taxon:178133"
                     /chromosome="1"
                     /tissue_type="leaf"
                     /dev_stage="Mature"
                     /country="Australia: New South Wales"
     gene            1..560
                     /gene="LOC115752846"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 100% coverage of the annotated
                     genomic feature by RNAseq alignments"
                     /db_xref="GeneID:115752846"
     CDS             88..540
                     /gene="LOC115752846"
                     /codon_start=1
                     /product="U-box domain-containing protein 7-like"
                     /protein_id="XP_048131084.1"
                     /db_xref="GeneID:115752846"
                     /translation="
MIILAFTFFISHFSTSPCTFLHRSLLEAAVCSPCFFFLRNKELILAAGVVPLLQEMTSNHDSHPSATALYLNLSCLEDAKPVLGLSQAVPFLTQLLKDETAPQCKLDAIHALYNLSTYHDNIGYLPSAGIISGLQSLLADLVTKCGQKSQ"
ORIGIN      
ttacttataacatgtttcaagagttgcttttttctttttgtataggagaaattaccatgctgttccttacatgctaaatggcacaacatgattattcttgccttcactttctttatctcccatttctccacctccccctgtactttcttgcatcgttctttgcttgaggcagcagtgtgttctccttgcttctttttcctcaggaacaaggagttgatattagctgccggagtcgttccgcttctccaggaaatgacatccaaccatgactctcatccatcagcaacggctctatatctgaatctttcctgccttgaagatgccaagcccgtactaggcttgagtcaggctgtaccctttcttacccagcttcttaaagatgaaactgcacctcagtgcaagcttgatgctattcacgccctttacaatctctccacctaccatgacaatattggatacctgccttcggcaggcattatcagtggccttcaatctcttcttgcagatctagtgaccaaatgtggacagaaaagtcaatagctgtccttatgaatttagat
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]