2024-04-25 09:28:29, GGRNA.v2 : RefSeq release 222 (Jan, 2024)
LOCUS XM_046683607 563 bp mRNA linear MAM 04-MAR-2023 DEFINITION PREDICTED: Equus quagga zinc finger protein 792-like (LOC124251107), mRNA. ACCESSION XM_046683607 VERSION XM_046683607.1 DBLINK BioProject: PRJNA805220 KEYWORDS RefSeq. SOURCE Equus quagga ORGANISM Equus quagga Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Laurasiatheria; Perissodactyla; Equidae; Equus. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_060279) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Updated annotation Annotation Name :: GCF_021613505.1-RS_2023_03 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 03/03/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..563 /organism="Equus quagga" /mol_type="mRNA" /isolate="Etosha38" /specimen_voucher="Etosha38" /db_xref="taxon:89248" /chromosome="13" /tissue_type="Blood" /country="Namibia:Etosha" /collection_date="2008" /collected_by="Pauline Kamath, UC Berkeley" gene 1..563 /gene="LOC124251107" /note="zinc finger protein 792-like; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 100% coverage of the annotated genomic feature by RNAseq alignments, including 1 sample with support for all annotated introns" /db_xref="GeneID:124251107" CDS 252..563 /gene="LOC124251107" /codon_start=1 /product="zinc finger protein 792-like" /protein_id="XP_046539563.1" /db_xref="GeneID:124251107" /translation="
MASGFVFKVSVTFEDVAVDLSQEEWELLDGTQRLLYHDVMLENFALVASLGLASSRFHVVAQLELRGETWVPDKADMTPATARGPWVGGLDLVNGKLLVLNGG"
misc_feature 282..464 /gene="LOC124251107" /note="krueppel associated box; Region: KRAB; smart00349" /db_xref="CDD:214630" ORIGIN
ggtgagactgagtgcagccacagttctccattgtcttctgggcaggctgaggatctgtgcctctgttccgagggtactgggagccatggaaggtttgacatagaagaggggagtgatctgaatcaggccttaacagactttctccggctgcagagtggagaacagacagtaggggtgagggctgcaatggtctaaatgagtgttggtgacacttggaccaggttggtggctgtggatctgagaggaaacgtatggcttctggatttgtttttaaggtcagcgtgacctttgaggatgtggctgtggacttatctcaggaggagtgggagcttcttgatgggactcagagactgctgtaccatgatgtgatgctggagaattttgcacttgtggcctcactgggacttgcatcttccaggttccacgtggttgcccaactggagctcaggggagagacctgggtgcctgacaaggcagacatgactccagccacagcaagagggccctgggttgggggactggacctggtaaatgggaagttgttggttttgaatggaggatga
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]