GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2024-04-25 09:28:29, GGRNA.v2 : RefSeq release 222 (Jan, 2024)

LOCUS       XM_046683607             563 bp    mRNA    linear   MAM 04-MAR-2023
DEFINITION  PREDICTED: Equus quagga zinc finger protein 792-like
            (LOC124251107), mRNA.
ACCESSION   XM_046683607
VERSION     XM_046683607.1
DBLINK      BioProject: PRJNA805220
KEYWORDS    RefSeq.
SOURCE      Equus quagga
  ORGANISM  Equus quagga
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Laurasiatheria; Perissodactyla; Equidae; Equus.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_060279) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Updated annotation
            Annotation Name             :: GCF_021613505.1-RS_2023_03
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 03/03/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..563
                     /organism="Equus quagga"
                     /mol_type="mRNA"
                     /isolate="Etosha38"
                     /specimen_voucher="Etosha38"
                     /db_xref="taxon:89248"
                     /chromosome="13"
                     /tissue_type="Blood"
                     /country="Namibia:Etosha"
                     /collection_date="2008"
                     /collected_by="Pauline Kamath, UC Berkeley"
     gene            1..563
                     /gene="LOC124251107"
                     /note="zinc finger protein 792-like; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 100%
                     coverage of the annotated genomic feature by RNAseq
                     alignments, including 1 sample with support for all
                     annotated introns"
                     /db_xref="GeneID:124251107"
     CDS             252..563
                     /gene="LOC124251107"
                     /codon_start=1
                     /product="zinc finger protein 792-like"
                     /protein_id="XP_046539563.1"
                     /db_xref="GeneID:124251107"
                     /translation="
MASGFVFKVSVTFEDVAVDLSQEEWELLDGTQRLLYHDVMLENFALVASLGLASSRFHVVAQLELRGETWVPDKADMTPATARGPWVGGLDLVNGKLLVLNGG"
     misc_feature    282..464
                     /gene="LOC124251107"
                     /note="krueppel associated box; Region: KRAB; smart00349"
                     /db_xref="CDD:214630"
ORIGIN      
ggtgagactgagtgcagccacagttctccattgtcttctgggcaggctgaggatctgtgcctctgttccgagggtactgggagccatggaaggtttgacatagaagaggggagtgatctgaatcaggccttaacagactttctccggctgcagagtggagaacagacagtaggggtgagggctgcaatggtctaaatgagtgttggtgacacttggaccaggttggtggctgtggatctgagaggaaacgtatggcttctggatttgtttttaaggtcagcgtgacctttgaggatgtggctgtggacttatctcaggaggagtgggagcttcttgatgggactcagagactgctgtaccatgatgtgatgctggagaattttgcacttgtggcctcactgggacttgcatcttccaggttccacgtggttgcccaactggagctcaggggagagacctgggtgcctgacaaggcagacatgactccagccacagcaagagggccctgggttgggggactggacctggtaaatgggaagttgttggttttgaatggaggatga
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]