GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2024-07-15 04:50:01, GGRNA.v2 : RefSeq release 224 (May, 2024)

LOCUS       XM_046188949             618 bp    mRNA    linear   PLN 28-JAN-2022
DEFINITION  Fusarium redolens Nitroreductase-like protein (BKA55DRAFT_527765),
            partial mRNA.
ACCESSION   XM_046188949
VERSION     XM_046188949.1
DBLINK      BioProject: PRJNA801210
            BioSample: SAMN05878234
KEYWORDS    RefSeq.
SOURCE      Fusarium redolens
  ORGANISM  Fusarium redolens
            Eukaryota; Fungi; Dikarya; Ascomycota; Pezizomycotina;
            Sordariomycetes; Hypocreomycetidae; Hypocreales; Nectriaceae;
            Fusarium; Fusarium redolens species complex.
REFERENCE   1  (bases 1 to 618)
  AUTHORS   Mesny,F., Miyauchi,S., Thiergart,T., Pickel,B., Atanasova,L.,
            Karlsson,M., Huettel,B., Barry,K.W., Haridas,S., Chen,C., Bauer,D.,
            Andreopoulos,W., Pangilinan,J., LaButti,K., Riley,R., Lipzen,A.,
            Clum,A., Drula,E., Henrissat,B., Kohler,A., Grigoriev,I.V.,
            Martin,F.M. and Hacquard,S.
  TITLE     Genetic determinants of endophytism in the Arabidopsis root
            mycobiome
  JOURNAL   Nat Commun (2021) In press
REFERENCE   2  (bases 1 to 618)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (28-JAN-2022) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 618)
  AUTHORS   Haridas,S., Mesny,F., Miyauchi,S., Thiergart,T., Pickel,B.,
            Atanasova,L., Karlsson,M., Huttel,B., Barry,K.W., Chen,C.,
            Bauer,D., Andreopoulos,W., Pangilinan,J., LaButti,K., Riley,R.,
            Lipzen,A., Henrissat,B., Kohler,A., Grigoriev,I.V., Martin,F.M. and
            Hacquard,S.
  CONSRTM   DOE Joint Genome Institute
  TITLE     Direct Submission
  JOURNAL   Submitted (05-APR-2021) DOE Joint Genome Institute, 2800 Mitchell
            Drive, Walnut Creek, CA 94598-1698, USA
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. This record is derived from an annotated genomic
            sequence (NW_025763690).
            
            ##Metadata-START##
            Organism Display Name :: Fusarium redolens MPI-CAGE-AT-0023
            ##Metadata-END##
            COMPLETENESS: incomplete on both ends.
FEATURES             Location/Qualifiers
     source          1..618
                     /organism="Fusarium redolens"
                     /mol_type="mRNA"
                     /strain="MPI-CAGE-AT-0023"
                     /db_xref="taxon:48865"
                     /chromosome="Unknown"
     gene            <1..>618
                     /locus_tag="BKA55DRAFT_527765"
                     /db_xref="GeneID:70218903"
     CDS             1..618
                     /locus_tag="BKA55DRAFT_527765"
                     /codon_start=1
                     /product="Nitroreductase-like protein"
                     /protein_id="XP_046042304.1"
                     /db_xref="GeneID:70218903"
                     /db_xref="InterPro:IPR029479"
                     /db_xref="JGIDB:Fusre1_527765"
                     /translation="
MAAELSANLFLQFVKSRRTYYPLSKNLPISTSRIQEIVNEAVLHTPTSFNSQSNRLVVLHGTEHEKLWDITIDTLKPIVPAANWTVTSDKLALFKGAAGTILFFNDITTVEGLQAKFVPFADKFPLWASQSLGMLQFVLWTALEAEGLGANLQHYNPLIDEKVAEAWRVPANWKLNAQLVFGGKTSEATAKQFNPLEDCVKVFGA"
     misc_feature    28..612
                     /locus_tag="BKA55DRAFT_527765"
                     /note="Fatty acid repression mutant protein (predicted
                     oxidoreductase) [General function prediction only];
                     Region: FMR2; COG3560"
                     /db_xref="CDD:442781"
ORIGIN      
atggccgctgaactctccgccaatctcttcttgcagttcgtcaagagccgacgaacctactaccccctctcaaagaaccttcccatctccacctctcgcatccaggagattgttaacgaggctgtcctgcatacccccacatcctttaactcccagtctaaccgtctggtcgtcctccacggcaccgagcatgagaagctgtgggacatcactattgacaccctgaagcctatcgtgcccgctgcgaactggacggtcactagtgataagctcgccttattcaagggcgccgctggtaccatcctcttcttcaatgatatcaccaccgtcgagggcctacaggccaaattcgtccccttcgccgacaagttccccttgtgggctagccagagtcttggcatgctgcagtttgtcctctggactgccctcgaggctgagggtctcggtgctaacctccagcactacaaccctctgatcgacgagaaggtcgccgaggcttggagggtccccgctaactggaagcttaatgcccagcttgtctttggtggcaagactagcgaggctaccgctaaacagttcaatcctctcgaggactgtgttaaggtgtttggtgcttag
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]