2025-09-18 23:06:54, GGRNA.v2 : RefSeq release 231 (Jul, 2025)
LOCUS XM_045755931 1377 bp mRNA linear INV 23-OCT-2024 DEFINITION PREDICTED: Procambarus clarkii golgin subfamily A member 6-like protein 22 (LOC123766652), mRNA. ACCESSION XM_045755931 VERSION XM_045755931.1 DBLINK BioProject: PRJNA1171844 KEYWORDS RefSeq; includes ab initio. SOURCE Procambarus clarkii (red swamp crayfish) ORGANISM Procambarus clarkii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Crustacea; Multicrustacea; Malacostraca; Eumalacostraca; Eucarida; Decapoda; Pleocyemata; Astacidea; Astacoidea; Cambaridae; Procambarus. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091211) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_040958095.1-RS_2024_10 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 10/17/2024 ##Genome-Annotation-Data-END## ##RefSeq-Attributes-START## ab initio :: 100% of CDS bases ##RefSeq-Attributes-END## FEATURES Location/Qualifiers source 1..1377 /organism="Procambarus clarkii" /mol_type="mRNA" /isolate="CNS0578487" /db_xref="taxon:6728" /chromosome="62" /sex="female" /tissue_type="muscle" /geo_loc_name="China: Hubei,Wuhan,Caidian" /lat_lon="30.41 N 113.78 E" /collection_date="2018-07" gene 1..1377 /gene="LOC123766652" /note="golgin subfamily A member 6-like protein 22; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 23 Proteins" /db_xref="GeneID:123766652" CDS 1..1377 /gene="LOC123766652" /codon_start=1 /product="golgin subfamily A member 6-like protein 22" /protein_id="XP_045611887.1" /db_xref="GeneID:123766652" /translation="
MTSWLYDDFMVQHKDEVIRTQQRKDELIRTQQHKDEVIRTQQRKDELIRTQQHKDEVIRTQQRKDELIRTQQHKDEVIRTQQRKDELIRTQQHKDEVIRTQQRKDELIRTQQHKDEVIRTQQHKDEVIRTQQHKDELIRTQQHKDELIRTQQHKDELIRTQQHKDELIRTQQHKDELIRTQQHKDELIRTQQHKDELIRTQQHKDELIRTQQHKDELIRTQQHKDELIRTQQHKDELIRTQQHKDELIRTQQHKDELIRTQQHKDELIRTQQHKDELIRTQQHKDELIRTQQHKDELIRTQQHKDELIRTQQHKDELIRTQQHKDELIRTQQRKDELIRTQQHKDELIRTQQHKDELIRTQQRKDELIRTQQHKDELIRTQQRKDELIRTQQHKDELIRTQQHKDELIRTQQHKDELIRTQQHKDELIRTQQHKDELIRTQQHKDELIRTQQQRTKTQ"
ORIGIN
atgacttcatggttgtatgatgacttcatggtgcaacacaaggatgaggtgatccgtacgcagcaacgcaaggatgagctcatccgtacgcagcaacacaaggatgaggtgatccgtacgcagcaacgcaaggatgagctcatccgtacgcagcaacacaaggatgaggtgatccgtacgcagcaacgcaaggatgagctcattcgtacgcagcaacacaaggatgaggtgatccgtacgcagcaacgcaaggatgagctcatccgtacgcagcaacacaaggatgaggtgatccgtacgcagcaacgcaaggatgagctcatccgtacgcagcaacacaaggatgaggtgatccgtacgcagcaacacaaggatgaggtgatccgtacgcagcaacacaaggatgagctcatccgtacgcagcaacacaaggatgagctcatccgtacgcagcaacacaaggatgagctcatccgtacgcagcaacacaaggatgagctcatccgtacgcagcaacacaaggatgagctcatccgtacgcagcaacacaaggatgagctcatccgtacgcagcaacacaaggatgagctcatccgtacgcagcaacacaaggatgagctcatccgtacgcagcaacacaaggatgagctcatccgtacgcagcaacacaaggatgagctcatccgtacgcagcaacacaaggatgagctcatccgtacgcagcaacacaaggatgagctcatccgtacgcagcaacacaaggatgagctcatccgtacgcagcaacacaaggatgagctgatccgtacgcagcaacacaaggatgagctcatccgtacgcagcaacacaaggatgagctgatccgtacgcagcaacacaaggatgagctgatccgtacgcagcaacacaaggatgagctcatccgtacgcagcaacacaaggatgagctcatccgtacgcagcaacacaaggatgagctgattcgtacgcagcaacgcaaggatgagctgatccgtacgcagcaacacaaggatgagctgatccgtacgcagcaacacaaggatgagctcatccgtacgcagcaacgcaaggatgagctcatccgtacgcagcaacacaaggatgagctgatccgtacgcagcaacgcaaggatgagctcatccgtacgcagcaacacaaggatgagctgatccgtacgcagcaacacaaggatgagctcatccgtacgcagcaacacaaggatgagctgatccgtacgcagcaacacaaggatgagctcatccgtacgcagcaacacaaggatgagctcatccgtacgcagcaacacaaggatgagctgatccgtacgcagcaacagcgtactaaaacacaataa
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]