LOCUS       XM_045755931            1377 bp    mRNA    linear   INV 23-OCT-2024
DEFINITION  PREDICTED: Procambarus clarkii golgin subfamily A member 6-like
            protein 22 (LOC123766652), mRNA.
ACCESSION   XM_045755931
VERSION     XM_045755931.1
DBLINK      BioProject: PRJNA1171844
KEYWORDS    RefSeq; includes ab initio.
SOURCE      Procambarus clarkii (red swamp crayfish)
  ORGANISM  Procambarus clarkii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Crustacea;
            Multicrustacea; Malacostraca; Eumalacostraca; Eucarida; Decapoda;
            Pleocyemata; Astacidea; Astacoidea; Cambaridae; Procambarus.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091211) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_040958095.1-RS_2024_10
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 10/17/2024
            ##Genome-Annotation-Data-END##
            
            ##RefSeq-Attributes-START##
            ab initio :: 100% of CDS bases
            ##RefSeq-Attributes-END##
FEATURES             Location/Qualifiers
     source          1..1377
                     /organism="Procambarus clarkii"
                     /mol_type="mRNA"
                     /isolate="CNS0578487"
                     /db_xref="taxon:6728"
                     /chromosome="62"
                     /sex="female"
                     /tissue_type="muscle"
                     /geo_loc_name="China: Hubei,Wuhan,Caidian"
                     /lat_lon="30.41 N 113.78 E"
                     /collection_date="2018-07"
     gene            1..1377
                     /gene="LOC123766652"
                     /note="golgin subfamily A member 6-like protein 22;
                     Derived by automated computational analysis using gene
                     prediction method: Gnomon. Supporting evidence includes
                     similarity to: 23 Proteins"
                     /db_xref="GeneID:123766652"
     CDS             1..1377
                     /gene="LOC123766652"
                     /codon_start=1
                     /product="golgin subfamily A member 6-like protein 22"
                     /protein_id="XP_045611887.1"
                     /db_xref="GeneID:123766652"
                     /translation="

MTSWLYDDFMVQHKDEVIRTQQRKDELIRTQQHKDEVIRTQQRKDELIRTQQHKDEVIRTQQRKDELIRTQQHKDEVIRTQQRKDELIRTQQHKDEVIRTQQRKDELIRTQQHKDEVIRTQQHKDEVIRTQQHKDELIRTQQHKDELIRTQQHKDELIRTQQHKDELIRTQQHKDELIRTQQHKDELIRTQQHKDELIRTQQHKDELIRTQQHKDELIRTQQHKDELIRTQQHKDELIRTQQHKDELIRTQQHKDELIRTQQHKDELIRTQQHKDELIRTQQHKDELIRTQQHKDELIRTQQHKDELIRTQQHKDELIRTQQHKDELIRTQQRKDELIRTQQHKDELIRTQQHKDELIRTQQRKDELIRTQQHKDELIRTQQRKDELIRTQQHKDELIRTQQHKDELIRTQQHKDELIRTQQHKDELIRTQQHKDELIRTQQHKDELIRTQQQRTKTQ"

ORIGIN      

atgacttcatggttgtatgatgacttcatggtgcaacacaaggatgaggtgatccgtacgcagcaacgcaaggatgagctcatccgtacgcagcaacacaaggatgaggtgatccgtacgcagcaacgcaaggatgagctcatccgtacgcagcaacacaaggatgaggtgatccgtacgcagcaacgcaaggatgagctcattcgtacgcagcaacacaaggatgaggtgatccgtacgcagcaacgcaaggatgagctcatccgtacgcagcaacacaaggatgaggtgatccgtacgcagcaacgcaaggatgagctcatccgtacgcagcaacacaaggatgaggtgatccgtacgcagcaacacaaggatgaggtgatccgtacgcagcaacacaaggatgagctcatccgtacgcagcaacacaaggatgagctcatccgtacgcagcaacacaaggatgagctcatccgtacgcagcaacacaaggatgagctcatccgtacgcagcaacacaaggatgagctcatccgtacgcagcaacacaaggatgagctcatccgtacgcagcaacacaaggatgagctcatccgtacgcagcaacacaaggatgagctcatccgtacgcagcaacacaaggatgagctcatccgtacgcagcaacacaaggatgagctcatccgtacgcagcaacacaaggatgagctcatccgtacgcagcaacacaaggatgagctcatccgtacgcagcaacacaaggatgagctcatccgtacgcagcaacacaaggatgagctgatccgtacgcagcaacacaaggatgagctcatccgtacgcagcaacacaaggatgagctgatccgtacgcagcaacacaaggatgagctgatccgtacgcagcaacacaaggatgagctcatccgtacgcagcaacacaaggatgagctcatccgtacgcagcaacacaaggatgagctgattcgtacgcagcaacgcaaggatgagctgatccgtacgcagcaacacaaggatgagctgatccgtacgcagcaacacaaggatgagctcatccgtacgcagcaacgcaaggatgagctcatccgtacgcagcaacacaaggatgagctgatccgtacgcagcaacgcaaggatgagctcatccgtacgcagcaacacaaggatgagctgatccgtacgcagcaacacaaggatgagctcatccgtacgcagcaacacaaggatgagctgatccgtacgcagcaacacaaggatgagctcatccgtacgcagcaacacaaggatgagctcatccgtacgcagcaacacaaggatgagctgatccgtacgcagcaacagcgtactaaaacacaataa

//