ver.2
Home
|
Help
|
Advanced search
Previous release (v1)
2026-02-06 22:43:03, GGRNA.v2 : RefSeq release 232 (Sep, 2025)
LOCUS XM_045755931 1377 bp mRNA linear INV 23-OCT-2024
DEFINITION PREDICTED: Procambarus clarkii golgin subfamily A member 6-like
protein 22 (LOC123766652), mRNA.
ACCESSION XM_045755931
VERSION XM_045755931.1
DBLINK BioProject: PRJNA1171844
KEYWORDS RefSeq; includes ab initio.
SOURCE Procambarus clarkii (red swamp crayfish)
ORGANISM Procambarus clarkii
Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Crustacea;
Multicrustacea; Malacostraca; Eumalacostraca; Eucarida; Decapoda;
Pleocyemata; Astacidea; Astacoidea; Cambaridae; Procambarus.
COMMENT MODEL REFSEQ: This record is predicted by automated computational
analysis. This record is derived from a genomic sequence
(NC_091211) annotated using gene prediction method: Gnomon.
Also see:
Documentation of NCBI's Annotation Process
##Genome-Annotation-Data-START##
Annotation Provider :: NCBI RefSeq
Annotation Status :: Full annotation
Annotation Name :: GCF_040958095.1-RS_2024_10
Annotation Pipeline :: NCBI eukaryotic genome annotation
pipeline
Annotation Software Version :: 10.3
Annotation Method :: Gnomon; cmsearch; tRNAscan-SE
Features Annotated :: Gene; mRNA; CDS; ncRNA
Annotation Date :: 10/17/2024
##Genome-Annotation-Data-END##
##RefSeq-Attributes-START##
ab initio :: 100% of CDS bases
##RefSeq-Attributes-END##
FEATURES Location/Qualifiers
source 1..1377
/organism="Procambarus clarkii"
/mol_type="mRNA"
/isolate="CNS0578487"
/db_xref="taxon:6728"
/chromosome="62"
/sex="female"
/tissue_type="muscle"
/geo_loc_name="China: Hubei,Wuhan,Caidian"
/lat_lon="30.41 N 113.78 E"
/collection_date="2018-07"
gene 1..1377
/gene="LOC123766652"
/note="golgin subfamily A member 6-like protein 22;
Derived by automated computational analysis using gene
prediction method: Gnomon. Supporting evidence includes
similarity to: 23 Proteins"
/db_xref="GeneID:123766652"
CDS 1..1377
/gene="LOC123766652"
/codon_start=1
/product="golgin subfamily A member 6-like protein 22"
/protein_id="XP_045611887.1"
/db_xref="GeneID:123766652"
/translation="
MTSWLYDDFMVQHKDEVIRTQQRKDELIRTQQHKDEVIRTQQRKDELIRTQQHKDEVIRTQQRKDELIRTQQHKDEVIRTQQRKDELIRTQQHKDEVIRTQQRKDELIRTQQHKDEVIRTQQHKDEVIRTQQHKDELIRTQQHKDELIRTQQHKDELIRTQQHKDELIRTQQHKDELIRTQQHKDELIRTQQHKDELIRTQQHKDELIRTQQHKDELIRTQQHKDELIRTQQHKDELIRTQQHKDELIRTQQHKDELIRTQQHKDELIRTQQHKDELIRTQQHKDELIRTQQHKDELIRTQQHKDELIRTQQHKDELIRTQQHKDELIRTQQRKDELIRTQQHKDELIRTQQHKDELIRTQQRKDELIRTQQHKDELIRTQQRKDELIRTQQHKDELIRTQQHKDELIRTQQHKDELIRTQQHKDELIRTQQHKDELIRTQQHKDELIRTQQQRTKTQ"
ORIGIN
atgacttcatggttgtatgatgacttcatggtgcaacacaaggatgaggtgatccgtacgcagcaacgcaaggatgagctcatccgtacgcagcaacacaaggatgaggtgatccgtacgcagcaacgcaaggatgagctcatccgtacgcagcaacacaaggatgaggtgatccgtacgcagcaacgcaaggatgagctcattcgtacgcagcaacacaaggatgaggtgatccgtacgcagcaacgcaaggatgagctcatccgtacgcagcaacacaaggatgaggtgatccgtacgcagcaacgcaaggatgagctcatccgtacgcagcaacacaaggatgaggtgatccgtacgcagcaacacaaggatgaggtgatccgtacgcagcaacacaaggatgagctcatccgtacgcagcaacacaaggatgagctcatccgtacgcagcaacacaaggatgagctcatccgtacgcagcaacacaaggatgagctcatccgtacgcagcaacacaaggatgagctcatccgtacgcagcaacacaaggatgagctcatccgtacgcagcaacacaaggatgagctcatccgtacgcagcaacacaaggatgagctcatccgtacgcagcaacacaaggatgagctcatccgtacgcagcaacacaaggatgagctcatccgtacgcagcaacacaaggatgagctcatccgtacgcagcaacacaaggatgagctcatccgtacgcagcaacacaaggatgagctcatccgtacgcagcaacacaaggatgagctgatccgtacgcagcaacacaaggatgagctcatccgtacgcagcaacacaaggatgagctgatccgtacgcagcaacacaaggatgagctgatccgtacgcagcaacacaaggatgagctcatccgtacgcagcaacacaaggatgagctcatccgtacgcagcaacacaaggatgagctgattcgtacgcagcaacgcaaggatgagctgatccgtacgcagcaacacaaggatgagctgatccgtacgcagcaacacaaggatgagctcatccgtacgcagcaacgcaaggatgagctcatccgtacgcagcaacacaaggatgagctgatccgtacgcagcaacgcaaggatgagctcatccgtacgcagcaacacaaggatgagctgatccgtacgcagcaacacaaggatgagctcatccgtacgcagcaacacaaggatgagctgatccgtacgcagcaacacaaggatgagctcatccgtacgcagcaacacaaggatgagctcatccgtacgcagcaacacaaggatgagctgatccgtacgcagcaacagcgtactaaaacacaataa
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]