LOCUS       XM_045099225             465 bp    mRNA    linear   PLN 12-NOV-2021
DEFINITION  PREDICTED: Hordeum vulgare subsp. vulgare protein argonaute 1D-like
            (LOC123405589), mRNA.
ACCESSION   XM_045099225
VERSION     XM_045099225.1
DBLINK      BioProject: PRJNA774802
KEYWORDS    RefSeq; includes ab initio.
SOURCE      Hordeum vulgare subsp. vulgare (domesticated barley)
  ORGANISM  Hordeum vulgare subsp. vulgare
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
            Spermatophyta; Magnoliopsida; Liliopsida; Poales; Poaceae; BOP
            clade; Pooideae; Triticodae; Triticeae; Hordeinae; Hordeum.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_058523.1) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Full annotation
            Annotation Name             :: Hordeum vulgare subsp. vulgare
                                           Annotation Release 100
            Annotation Version          :: 100
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 9.0
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
            
            ##RefSeq-Attributes-START##
            ab initio :: 23% of CDS bases
            ##RefSeq-Attributes-END##
FEATURES             Location/Qualifiers
     source          1..465
                     /organism="Hordeum vulgare subsp. vulgare"
                     /mol_type="mRNA"
                     /sub_species="vulgare"
                     /db_xref="taxon:112509"
                     /chromosome="6H"
     gene            1..465
                     /gene="LOC123405589"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 2 Proteins"
                     /db_xref="GeneID:123405589"
     CDS             1..465
                     /gene="LOC123405589"
                     /codon_start=1
                     /product="protein argonaute 1D-like"
                     /protein_id="XP_044955160.1"
                     /db_xref="GeneID:123405589"
                     /translation="

MSATTFIEPLPVIDYAAQLLRSDIHSRPLSDAERVKIKKALRGVKVEVTHRGNMRRKYRISGLTTQATRELTFPVDEGGTIKSVVQYFQETYGFAIKHTYLPCLQVGNQQRPNYLPMEKISLGNKQQYQLQMQLFSGDAIRIPRRPIDSSPNSN"

     misc_feature    25..354
                     /gene="LOC123405589"
                     /note="PAZ domain, argonaute_like subfamily. Argonaute is
                     part of the RNA-induced silencing complex (RISC), and is
                     an endonuclease that plays a key role in the RNA
                     interference pathway. The PAZ domain has been named after
                     the proteins Piwi,Argonaut, and Zwille; Region:
                     PAZ_argonaute_like; cd02846"
                     /db_xref="CDD:239212"
     misc_feature    order(172..174,217..219,250..252,262..264,316..318,
                     337..339,343..345)
                     /gene="LOC123405589"
                     /note="nucleic acid-binding interface [nucleotide
                     binding]; other site"
                     /db_xref="CDD:239212"
ORIGIN      

atgtcagcgacaactttcattgagccattgcctgtgatagattacgccgcacagctgctgcgttctgacatccattcgaggcccctctcagacgctgaacgtgttaagatcaagaaggcgctgagaggagtaaaggtggaagttactcatcgtggcaacatgagaaggaagtaccgaatatctggtctgacaactcaggcaactcgagagctaacttttcctgttgatgaagggggcacaataaagtcagttgtacaatactttcaggagacatatggctttgccatcaagcacacataccttccttgcctccaagttggcaatcagcaacgtccaaattatttgcctatggagaaaatttcgctgggaaacaaacagcagtaccaactgcagatgcaattgtttagtggagatgcaattcgcatcccccggagaccaatcgattcgtccccaaattccaactag

//