LOCUS       XM_044760012            1879 bp    mRNA    linear   MAM 18-DEC-2024
DEFINITION  PREDICTED: Equus asinus Meis homeobox 3 (MEIS3), transcript variant
            X9, mRNA.
ACCESSION   XM_044760012
VERSION     XM_044760012.2
DBLINK      BioProject: PRJNA1198117
KEYWORDS    RefSeq.
SOURCE      Equus asinus (ass)
  ORGANISM  Equus asinus
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Laurasiatheria; Perissodactyla; Equidae; Equus.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091815) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 18, 2024 this sequence version replaced XM_044760012.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_041296235.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/16/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1879
                     /organism="Equus asinus"
                     /mol_type="mRNA"
                     /isolate="D_3611"
                     /db_xref="taxon:9793"
                     /chromosome="26"
                     /sex="male"
                     /tissue_type="Whole blood in anticoagulant"
                     /geo_loc_name="USA: Ithaca, New York"
                     /collection_date="2018-03-01"
                     /breed="Donkey"
     gene            1..1879
                     /gene="MEIS3"
                     /note="Meis homeobox 3; Derived by automated computational
                     analysis using gene prediction method: Gnomon. Supporting
                     evidence includes similarity to: 4 long SRA reads, 1
                     Protein"
                     /db_xref="GeneID:106845156"
     CDS             202..1407
                     /gene="MEIS3"
                     /codon_start=1
                     /product="homeobox protein Meis3 isoform X1"
                     /protein_id="XP_044615947.1"
                     /db_xref="GeneID:106845156"
                     /translation="

MARRYDELPHYPGIVDGTAALAGFSEAVPTAPRAPGPYGPHRPPQPPPLGLDSDGLKREKDEIYGHPLFPLLALVFEKCELATCSPRDVAGAGLGTPPGGDLCSSDSFNEDIAAFAKQVRSERPLFSSNPELDNLMIQAIQVLRFHLLELEKVHDLCDNFCHRYITCLKGKMPIDLVIEDRDGGCREDLEDYPASCPSLPDQTNTWIRDHEDSGSVHLGTPGPSSGGLASQSGDNSSDQGDGLDTSVASPSSGGEDEELDQERRRNKKRGIFPKVATNIMRAWLFQHLSMTGQALGIGWRPGRQGDSRWWSQHPYPSEEQKKQLAQDTGLTILQVNNWFINARRRIVQPMIDQSNRTGQGAAFSPEGQPVGGYTETQPHMTVRPPGSMGMSLNLEGEWHYL"

     misc_feature    496..750
                     /gene="MEIS3"
                     /note="N-terminal of Homeobox Meis and PKNOX1; Region:
                     Meis_PKNOX_N; pfam16493"
                     /db_xref="CDD:465140"
     misc_feature    1138..1236
                     /gene="MEIS3"
                     /note="Homeobox KN domain; Region: Homeobox_KN; pfam05920"
                     /db_xref="CDD:428673"
ORIGIN      

ctgggggtccatgcgcgcagcctgctccccgcccggcgccggccgctgacggccgtgggggggtgggggagccgggcacccagcctcctgccccaccccctggcgtcggccccatcggccacccgggccgctgcccctggctgcgccctccccgccggccaggccctggagggacccgggagcggccgccggcttcagcccatggcccggaggtacgatgagctgcctcactacccaggcatcgtggatggcactgcagccctggctggcttctcggaggcagtgcccacagcaccgagagccccggggccctacggcccccaccggcctcctcagccccctcccctgggcttggacagcgatggcctgaagagagagaaggacgagatctacggacacccgctcttccccctgctggccctggtctttgagaaatgtgaactggccacgtgctcacctcgtgacgtggccggggctgggctgggcacgcccccgggcggcgacctctgctcctccgactccttcaatgaggacattgccgcttttgccaagcaggtccgctccgagaggcccctcttctcctccaacccggagctggacaatctgatgatccaggccatccaggtgctccggttccacctgctggagctggagaaggtccacgacctgtgcgacaacttctgtcatcgctacatcacctgcctcaagggaaagatgcccatcgacctggtcatcgaggatcgggacggcggctgcagggaggacctcgaggactacccggcctcctgccccagcctcccggatcagactaacacatggattagagaccatgaggacagtgggtctgtacatttggggaccccgggtccatccagtggtggcctggcctcccagagtggggacaactctagtgaccaaggagacggactggacacaagcgtggcctctcccagttctgggggagaggacgaggagctggaccaggagcggcgtcggaacaagaagcggggcatcttccccaaggtggccaccaacatcatgagagcctggctgttccagcacctctcgatgacaggccaggccttggggatcggatggcggcccggcaggcagggtgactctcgctggtggtcacagcacccgtacccctcggaggagcagaagaaacagctggcgcaggacacggggctcacgattctgcaagtcaacaactggttcattaacgcccggagacgcatcgtgcaacccatgatcgatcaatccaaccgcacagggcagggtgcagccttcagcccagagggccagcccgtagggggctacacggagactcagccacacatgactgtgaggccgccagggtcaatggggatgagtttgaacttagaaggagagtggcattatctatagacgctggactcaagagaagtaccccagcctccggaccaccaccaccaggctcacacctggttctggtccccgcttggccctctggcttcaggacccccacctcctccggccccctcactcaacgcctacctccctggggccccgccgggacatggggggcctgagcgccccctcgagggcctctcaaggacaaagacaaggcctccaggccctgcgccccacttctgccctcacctccgcccagaacccgagctgagatcctgggcccgagtcttcggaagatggtggctgggggtccccccgcctccaggacaaggaagggattggaggtgggctgggccatgagggacgggggttcacctggaccctacattttggagacgttcccttcatcccccagcccgcccccctcccctctccgcctacctcccttctctgatgtcttctactttgtttttaacgataaagtctt

//