2024-03-29 06:51:03, GGRNA.v2 : RefSeq release 222 (Jan, 2024)
LOCUS XM_044588501 675 bp mRNA linear PLN 25-OCT-2021 DEFINITION PREDICTED: Triticum aestivum protein argonaute MEL1-like (LOC123170705), partial mRNA. ACCESSION XM_044588501 VERSION XM_044588501.1 DBLINK BioProject: PRJNA764258 KEYWORDS RefSeq; includes ab initio. SOURCE Triticum aestivum (bread wheat) ORGANISM Triticum aestivum Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta; Spermatophyta; Magnoliopsida; Liliopsida; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_057814.1) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI Annotation Status :: Full annotation Annotation Name :: Triticum aestivum Annotation Release 100 Annotation Version :: 100 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 9.0 Annotation Method :: Best-placed RefSeq; Gnomon Features Annotated :: Gene; mRNA; CDS; ncRNA ##Genome-Annotation-Data-END## ##RefSeq-Attributes-START## ab initio :: 37% of CDS bases ##RefSeq-Attributes-END## COMPLETENESS: incomplete on the 3' end. FEATURES Location/Qualifiers source 1..675 /organism="Triticum aestivum" /mol_type="mRNA" /cultivar="Chinese Spring" /db_xref="taxon:4565" /chromosome="7D" /tissue_type="leaf" /dev_stage="Vegetative" /country="USA: Davis, California" gene 1..>675 /gene="LOC123170705" /note="Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 62% coverage of the annotated genomic feature by RNAseq alignments" /db_xref="GeneID:123170705" CDS 1..>675 /gene="LOC123170705" /codon_start=1 /product="protein argonaute MEL1-like" /protein_id="XP_044444436.1" /db_xref="GeneID:123170705" /translation="
MHIYTITLFPSEYEKEYVIELNEGASEDASRSVSYSVTIHLAKSLKMQELKDYYNGEQSYVSQDILHAINVVVRALSSSCLNAPRAMFSTKFGPIIDTKEGLELWQGCYKGVCLSHYGLDLTIDTTVAPFYKSISMVKFVGEFLGRTDFNRAFSHKEYAKIERALKGVQVETIHHTDRTMKYRIKGLSVVPLKELMFSVDDDGIMTTVVDYYQSRYNCKLEYIHW"
misc_feature 91..>666 /gene="LOC123170705" /note="protein argonaute; Provisional; Region: PLN03202" /db_xref="CDD:215631" misc_feature 397..>675 /gene="LOC123170705" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" ORIGIN
atgcatatctacacaatcactcttttcccatctgagtatgaaaaagagtatgtcattgaactgaatgaaggtgctagtgaggatgcgtcgaggagtgttagttatagtgtcacaattcatttggctaagtcactgaaaatgcaagagttgaaggactattacaatggagaacaaagttatgtttctcaggatattttacatgcaattaatgttgtcgtgagagcattatcttcaagctgtctcaatgctccaagggcaatgttttcaaccaagtttggtccgataatagacactaaagaggggctcgagctttggcaggggtgctacaagggagtttgcttgtcacattatggtcttgatttgaccatagatacaactgtagcacctttttataaatcaatttccatggtcaagtttgtgggtgaatttttgggccgaactgacttcaaccgggctttctctcataaagagtatgcaaagatagaaagagctttgaaaggggtccaagttgaaactatccatcatactgatagaactatgaagtacagaattaaagggcttagtgttgtccctttgaaagagctcatgttttctgtagatgatgatggtatcatgaccaccgttgttgattattatcagagtcggtataattgcaaattggaatatattcactgg
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]