2024-04-27 01:51:52, GGRNA.v2 : RefSeq release 222 (Jan, 2024)
LOCUS XM_043873501 1897 bp mRNA linear MAM 27-SEP-2021 DEFINITION PREDICTED: Cervus elaphus engrailed homeobox 2 (EN2), mRNA. ACCESSION XM_043873501 VERSION XM_043873501.1 DBLINK BioProject: PRJNA764704 KEYWORDS RefSeq. SOURCE Cervus elaphus (red deer) ORGANISM Cervus elaphus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Laurasiatheria; Artiodactyla; Ruminantia; Pecora; Cervidae; Cervinae; Cervus. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_057832.1) annotated using gene prediction method: Gnomon, supported by EST evidence. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI Annotation Status :: Full annotation Annotation Name :: Cervus elaphus Annotation Release 100 Annotation Version :: 100 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 9.0 Annotation Method :: Best-placed RefSeq; Gnomon Features Annotated :: Gene; mRNA; CDS; ncRNA ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..1897 /organism="Cervus elaphus" /mol_type="mRNA" /db_xref="taxon:9860" /chromosome="18" gene 1..1897 /gene="EN2" /note="Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 EST, 2 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 9 samples with support for all annotated introns" /db_xref="GeneID:122674889" CDS 488..1462 /gene="EN2" /codon_start=1 /product="homeobox protein engrailed-2" /protein_id="XP_043729436.1" /db_xref="GeneID:122674889" /translation="
MEENDPKPSEAAAAEGQRPPECSPSGGAGSPGEADTGRRRALMLPAVLQAPGNHQHPHRITNFFIDNILRPEFGRRKDAGTCCPGAGGGRGAGAGGEGGLEGGGGAGGAEQLLVSGREPRQNAPGAPGAGGPLPGGGGSDSPGDGEGGSKALSLHSGAKKGGDPGGPLDGALKARGLGGGDLSVSSDSDSSQASANLGAQPMLWPAWVYCTRYSDRPSSGPRSRKPKKKNPNKEDKRPRTAFTAEQLQRLKAEFQTNRYLTEQRRQSLAQELSLNESQIKIWFQNKRAKIKKATGSKNTLAVHLMAQGLYNHSTTAKEGKSDSE"
misc_feature order(1193..1207,1211..1213,1262..1264,1280..1282, 1319..1321,1325..1330,1337..1342,1346..1354,1358..1363) /gene="EN2" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 1199..1360 /gene="EN2" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:425441" misc_feature order(1199..1201,1208..1210,1328..1330,1337..1342, 1349..1351) /gene="EN2" /note="specific DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" misc_feature 1364..1456 /gene="EN2" /note="Engrailed homeobox C-terminal signature domain; Region: Engrail_1_C_sig; pfam10525" /db_xref="CDD:431338" polyA_site 1897 /gene="EN2" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN
cggcgttggcccgagcgggccccggcgggcgtgagcgcgggcgagcgcgctgcctgcatgcgcggagctccagccccgggcggccgggcggcggcggcggcgccggagccggaggcagccggacgtggagaggcgcgcggagccccgaggcgccccgggtccgcgccggacccttgtgaccgtctagcgactgggtgcgctgcgaagactcggaccggactattttgaatctcccggcgtctgggcgtggggcgactcttggtattttctaactcaacttgtggatctgaacgtggctttggctctgagcgtggctggcgacgtgtaggaccccagccctggctgctgccgccgcgctcgccctcgggagagtcggcggggaagggacaccggccggcttcggaagtctccgcgtacggagcggagaagcggaaggctgactggagggtctccccggagaatcgactcgggatttgttgtgagcagcatggaggagaatgaccccaagcctagcgaagcggcggcggcggaggggcagcggccgccggaatgcagccccagcggcggcgccggcagccctggcgaggcggacactggccgccggcgggctctgatgctgcctgcggtcctgcaggcccccggcaaccaccagcacccacaccgcatcaccaacttcttcatcgacaacatcctgcggcccgagttcggccggagaaaggacgcagggacgtgctgtcccggcgccggaggaggcagaggcgccggggcaggcggcgaaggcggcctggagggaggcggcggcgcgggcggcgcggagcagctcctggtgtctggccgggagccccggcagaacgcgcccggggcgcccggggcgggcgggccgctgcccggcggtggcggtagcgactctccgggtgacggcgaaggcggctctaaagcgctctcactgcacagcggcgccaagaaaggaggagaccccgggggtcccctggacggggcgctcaaggcccgcggcttgggcggcggcgacctgtcggtgagctcagactcggacagttcgcaggccagcgccaacctgggcgcgcagcccatgctctggccggcttgggtctactgcacgcgctactcggaccgaccttcttcaggtcccaggtctcgcaaaccaaagaagaagaaccccaacaaagaggacaagcggccccgcacggccttcacggcagagcagctgcagcggctcaaggccgagttccagaccaacaggtaccttacggagcagcggcgccagagcctggcgcaggagctcagcctcaacgagtctcagatcaagatctggttccagaacaagcgcgccaagatcaagaaggccacgggcagcaagaacacgctggccgtgcacctcatggcgcagggcctgtacaaccactccaccaccgccaaggagggcaagtcggacagcgagtagggcgggcgggtgccacgtcccggcccgccctggctaaacgatgcaataatttaaaatcagaaatcaagggccagtgtataaagattataccagcattcatagtgaagatatcgtgtattagctatggttctgcaatattctatgtatatataatttacaggaggtgtaaaatccaaaatatctgactataaaatattttttgagtttttttatgtttatgagattatgctaattttatgttgggtttttggtttttgcaaagggggctacttagggtttcatcttttttaatcccctaagttccattatgggacatcggacactttttttttttaatttcaaaagatgaaaaaattaaaacaacttgctgaagtccaaagatttttattgctgcatttcacacgactgtgaaccgaataaatagctcctacttgg
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]