LOCUS       XM_043780082            2278 bp    mRNA    linear   PLN 21-SEP-2021
DEFINITION  PREDICTED: Erigeron canadensis protein argonaute MEL1-like
            (LOC122607154), mRNA.
ACCESSION   XM_043780082
VERSION     XM_043780082.1
DBLINK      BioProject: PRJNA763527
KEYWORDS    RefSeq.
SOURCE      Erigeron canadensis
  ORGANISM  Erigeron canadensis
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
            Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae;
            Pentapetalae; asterids; campanulids; Asterales; Asteraceae;
            Asteroideae; Astereae; North American clade; Conyzinae; Erigeron.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_057761.1) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Full annotation
            Annotation Name             :: Erigeron canadensis Annotation
                                           Release 100
            Annotation Version          :: 100
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 9.0
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..2278
                     /organism="Erigeron canadensis"
                     /mol_type="mRNA"
                     /isolate="Cc75"
                     /db_xref="taxon:72917"
                     /chromosome="1"
                     /tissue_type="leaves"
                     /country="Canada"
     gene            1..2278
                     /gene="LOC122607154"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 14 Proteins, and 100% coverage of
                     the annotated genomic feature by RNAseq alignments"
                     /db_xref="GeneID:122607154"
     CDS             264..2075
                     /gene="LOC122607154"
                     /codon_start=1
                     /product="protein argonaute MEL1-like"
                     /protein_id="XP_043636017.1"
                     /db_xref="GeneID:122607154"
                     /translation="

MGMSLNLQMSARAYYQPTLVYDFTREFLGRDTSGPLSAGEHRKVAKAVKGLKVEVDGENYTRKFNVLGLTTEPLGDLRFVESYTPLNLNFPAILIGTAISPKYIPMELCRIAPGQSYPLTNRKQADRFHMYACDPPLHRKNNICMTVRDNKYNINSLVRVTEQMTTIDARVLPPPAITYYSSVEGLKDFIPVNGQWTLTDKNFVNAGTVNRWGIANFSRRNIYGIGYFCGKVVQMCRKMGMVFNPIPMFQRSYPPVDIAKILKDIKAEYHHLDLLFVILPDDKEVYAIIKRVCETDIGVITQCFRHRNVEEVTNDYLEHVALKINVKVGGRNTFLSAAHNRTLRYVSEVFTIIMGADVTHPIPGDRSSPSIAAVVASMDWPELTRYRAMFSAQSNGMEIIQDERLIREQLLSFYQTHGKPERIIYYRDGVGDSQFRRLLDSELGLIRKACESLAENYRPNVTFIVMIKRHNTRLFPSLDHDSSGNVLPGTVVDTQICNPTDFNFFLCSHAGIKGTSRPAHYYLLHDENGFTADGLERLTYDLCYICVRGTRSISIVAPVYYADLAAYRARCYIEGDRAERQVADELIELPAIHEDLRNVMFYC"

     misc_feature    321..599
                     /gene="LOC122607154"
                     /note="PAZ domain, argonaute_like subfamily. Argonaute is
                     part of the RNA-induced silencing complex (RISC), and is
                     an endonuclease that plays a key role in the RNA
                     interference pathway. The PAZ domain has been named after
                     the proteins Piwi,Argonaut, and Zwille; Region:
                     PAZ_argonaute_like; cd02846"
                     /db_xref="CDD:239212"
     misc_feature    order(453..455,498..500,501..503,546..548,567..569,
                     573..575)
                     /gene="LOC122607154"
                     /note="nucleic acid-binding interface [nucleotide
                     binding]; other site"
                     /db_xref="CDD:239212"
     misc_feature    735..1982
                     /gene="LOC122607154"
                     /note="PIWI domain, Argonaute-like subfamily. Argonaute is
                     the central component of the RNA-induced silencing complex
                     (RISC) and related complexes. The PIWI domain is the
                     C-terminal portion of Argonaute and consists of two
                     subdomains, one of which provides the...; Region:
                     Piwi_ago-like; cd04657"
                     /db_xref="CDD:240015"
     misc_feature    order(1119..1121,1131..1133,1167..1178,1185..1187,
                     1209..1211,1218..1220,1230..1232,1242..1244)
                     /gene="LOC122607154"
                     /note="5' RNA guide strand anchoring site [active]"
                     /db_xref="CDD:240015"
     misc_feature    order(1332..1334,1338..1340,1545..1547,1950..1952)
                     /gene="LOC122607154"
                     /note="active site"
                     /db_xref="CDD:240015"
     polyA_site      2278
                     /gene="LOC122607154"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      

agacaaaaatcctcttctatatacaatccacacctcttgttaggtgttgcggtccatcaactttgtaccttttaaattttcagattgacccgactaagcgtcgccaaacatttaaacgtatcaatctgttgctcaagcaggctgcatcactagaccaagcatactcaggaaaattgttattttctgaaaattttgaaagaagggatattggaggtggaggagagctttgctgggggtttaagcagtctctcaaagaaactcaaatgggcatgtccctcaatttgcagatgtctgccagggcttattatcagcccacgttagtctacgattttactagagagtttctcgggagagatacatcagggccactttcagccggagaacatcgtaaggtcgcaaaagctgtcaaaggccttaaggtggaagttgatggtgagaattacaccagaaagtttaatgttctagggttgaccacagaaccgcttggagacctaaggtttgttgaaagctacacaccgctgaatctaaattttcctgccatattaatcgggactgcaatatcgcccaaatatattccaatggagctttgcagaatagctcctgggcaaagttatcctctgaccaatcgaaagcaagcggacagatttcatatgtacgcatgcgaccccccgttgcacagaaaaaataacatatgcatgacggttagagataataagtacaatatcaatagtttggtgagagtgactgaacagatgacaactatagatgcacgggttcttccaccacccgctatcacctattattcttcagtggaaggcttgaaagactttatcccagtcaacggtcaatggacgttgactgataagaacttcgtgaatgctggaacggttaatcgttggggcattgccaacttctcccgaagaaatatctatggtataggctacttttgtggtaaagtcgttcagatgtgcaggaagatgggaatggtatttaatcccatacccatgttccaaagatcttatccgcctgtcgacattgccaagattctaaaggatatcaaggctgagtaccaccatctagaccttttatttgtgatacttccggacgacaaagaagtatacgctatcattaaacgagtctgcgaaacggatattggggtaatcacccagtgttttagacatagaaatgtggaagaagtcacaaatgactatcttgagcacgtggctttgaagattaatgttaaggtggggggcaggaatacttttttgtctgcagctcacaatagaaccctccgatatgttagtgaagtttttaccataattatgggggctgatgtaacacacccaataccaggagacagatccagcccttcgattgctgctgtggtagcatctatggactggcccgaactaacgaggtacagagccatgttctctgcacagtcgaatgggatggaaataattcaggatgaacgtttaataagggagcaattgctatccttttaccaaacacatggaaaacctgaaagaattatatactatagagacggagttggtgatagccagtttagacggctcctagacagcgaactgggcctcatccgcaaggcttgtgaatccttggccgagaattatagacctaatgtgacttttatagtcatgataaaacgacacaatactcgcctctttccttcgttggatcatgatagcagtggcaatgttcttcctggtactgtggttgatacgcaaatctgtaacccgactgatttcaacttctttctatgcagtcatgctggtattaagggaacgagtcggcccgcccactactatcttcttcatgatgagaatggattcactgctgatgggttggaaaggcttacatatgatttgtgctatatatgtgtaaggggtacccgatcgatttcaattgtcgccccggtgtattatgcagatttagctgcgtatcgtgctcgctgctacattgaaggagatcgtgctgaaaggcaagtggctgatgaattaatagagttaccagcgattcatgaagatctcagaaatgtgatgttctactgttaggtgagtttgtagggattattcaaagtggaaattttggatttgatatgtttgttagatcatccccctgtcgattgatgtaaataatagttagtatattgcaaaaaagagtgtgctttgctgccaagcatgctacatgtgacagcattctatgatgatatgatagttctgaatagaaaggttaactgttggtattacttagaaaa

//