GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2026-09-14 05:32:57, GGRNA.v2 : RefSeq release 233 (Jan, 2026)

LOCUS       XM_041563893            1522 bp    mRNA    linear   VRT 14-MAY-2021
DEFINITION  PREDICTED: Xenopus laevis claudin 1 S homeolog (cldn1.S),
            transcript variant X1, mRNA.
ACCESSION   XM_041563893
VERSION     XM_041563893.1
DBLINK      BioProject: PRJNA338693
KEYWORDS    RefSeq.
SOURCE      Xenopus laevis (African clawed frog)
  ORGANISM  Xenopus laevis
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Amphibia; Batrachia; Anura; Pipoidea; Pipidae; Xenopodinae;
            Xenopus; Xenopus.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_054380.1) annotated using gene prediction method: Gnomon,
            supported by mRNA and EST evidence.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Full annotation
            Annotation Name             :: Xenopus laevis Annotation Release
                                           101
            Annotation Version          :: 101
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 8.6
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1522
                     /organism="Xenopus laevis"
                     /mol_type="mRNA"
                     /strain="J_2021"
                     /db_xref="taxon:8355"
                     /chromosome="5S"
                     /sex="female"
                     /tissue_type="Erythrocytes"
                     /dev_stage="adult"
                     /collection_date="06-Jul-2016"
                     /collected_by="Jessica Lyons"
     gene            1..1522
                     /gene="cldn1.S"
                     /gene_synonym="claudin-1; cld1; cldn1; ilvasc; semp1"
                     /note="claudin 1 S homeolog; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 2
                     mRNAs, 10 ESTs, 31 Proteins, and 100% coverage of the
                     annotated genomic feature by RNAseq alignments, including
                     35 samples with support for all annotated introns"
                     /db_xref="GeneID:379132"
                     /db_xref="Xenbase:XB-GENE-951614"
     CDS             191..826
                     /gene="cldn1.S"
                     /gene_synonym="claudin-1; cld1; cldn1; ilvasc; semp1"
                     /codon_start=1
                     /product="claudin 1 S homeolog isoform X1"
                     /protein_id="XP_041419827.1"
                     /db_xref="GeneID:379132"
                     /db_xref="Xenbase:XB-GENE-951614"
                     /translation="
MANAGLQLLGFALACLGWIGFIVCIAIPQWKMSSFAGDAIITAQITYEGLWMSCVMQSTGQMQCKSFDSLLKLDSTIQATRALMICGILVGFFAMCIAAVGMKCLTCLQDDEVKKAKVGVVGGALFIVAGLCVLIATAWYGDKIAKDFYNMFTPTNSKYEFGPALFIGWAGAALAIIGGALLCCSCPRKETSYPPPRGYNKSAPPAGKDYV"
     misc_feature    203..736
                     /gene="cldn1.S"
                     /gene_synonym="claudin-1; cld1; cldn1; ilvasc; semp1"
                     /note="PMP-22/EMP/MP20/Claudin family; Region:
                     PMP22_Claudin; cl21598"
                     /db_xref="CDD:473919"
ORIGIN      
ataagcagaagttttcatttaggaaatagacttggcagaccactgatcaactctttcttctctacttttttcttacttgggaagttttcagtctacatttacctaagagtcctccttaaacttcagcagaacagacaaggcctgcttcagagtgaggccaagttgtaacttactttatccactccaaaggatggccaacgcaggcttgcaacttttaggattcgccttagcttgtctgggctggattgggtttatagtatgtattgcaatccctcaatggaaaatgtcatcatttgctggggatgccattatcacagcacagataacctatgaaggactctggatgtcttgtgtaatgcagagcacagggcagatgcagtgcaaatcttttgactcattgctgaagctggacagtactatacaggccacccgagcattgatgatctgtggaattcttgttggtttctttgccatgtgcattgctgcagtagggatgaaatgcttgacatgtcttcaggatgatgaagtaaagaaggcaaaggttggagtagtgggaggagcactcttcattgttgctggtctctgtgttttgatagcaacagcttggtatggagataaaatcgcaaaggatttttacaatatgttcacaccaaccaattctaaatatgagtttggccctgccttatttattggatgggctggagctgcgctagcaatcattggaggtgctttgctctgttgctcttgtcccagaaaagagacttcctacccaccaccaagaggctacaataaaagtgcaccacctgctggaaaagattatgtgtaacaaaggaaatactgtatgcaactaccatggggacattaggacattattctccacttatttcattaatgttaaaggcattgcattgccttagattcagcaacagtaccatgctgtcatgttattcagcaacccagtatagcaatgacagtgataagttaatgcaggaagatattaaaatcttaaaagtcaacaatatgaattagaaaacagaaggttgtgcagatgtcagctttaatctatgtcatattattgtcttcacaaaacccacaccctaatcctataaagcttgcctaattatatacaaatactgtatatatatatatatatatatatatatatatatatatatatatatatatatatatatatatatatatatatatatataccatacttcatatcagcttcatatataactagcaacagcaatcatggttctttttcccttttgttttggtacaatataaattgcaagaattggttatattctgtgttatttctgtataaatctattttttttgttttgtatatgactgttattttcaataagcaatagtaatgaattctgtttcaaggcagaactgaatccaagcatggggtacaatgtacagacatggtttcaggcaattttttgtcagttttgtggattacttccattatgtgatttttttaataaataagacttttacaagaaaa
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]