2025-07-02 10:25:11, GGRNA.v2 : RefSeq release 229 (Mar, 2025)
LOCUS XM_041563893 1522 bp mRNA linear VRT 14-MAY-2021 DEFINITION PREDICTED: Xenopus laevis claudin 1 S homeolog (cldn1.S), transcript variant X1, mRNA. ACCESSION XM_041563893 VERSION XM_041563893.1 DBLINK BioProject: PRJNA338693 KEYWORDS RefSeq. SOURCE Xenopus laevis (African clawed frog) ORGANISM Xenopus laevis Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Amphibia; Batrachia; Anura; Pipoidea; Pipidae; Xenopodinae; Xenopus; Xenopus. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_054380.1) annotated using gene prediction method: Gnomon, supported by mRNA and EST evidence. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI Annotation Status :: Full annotation Annotation Name :: Xenopus laevis Annotation Release 101 Annotation Version :: 101 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 8.6 Annotation Method :: Best-placed RefSeq; Gnomon Features Annotated :: Gene; mRNA; CDS; ncRNA ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..1522 /organism="Xenopus laevis" /mol_type="mRNA" /strain="J_2021" /db_xref="taxon:8355" /chromosome="5S" /sex="female" /tissue_type="Erythrocytes" /dev_stage="adult" /collection_date="06-Jul-2016" /collected_by="Jessica Lyons" gene 1..1522 /gene="cldn1.S" /gene_synonym="claudin-1; cld1; cldn1; ilvasc; semp1" /note="claudin 1 S homeolog; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 2 mRNAs, 10 ESTs, 31 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 35 samples with support for all annotated introns" /db_xref="GeneID:379132" /db_xref="Xenbase:XB-GENE-951614" CDS 191..826 /gene="cldn1.S" /gene_synonym="claudin-1; cld1; cldn1; ilvasc; semp1" /codon_start=1 /product="claudin 1 S homeolog isoform X1" /protein_id="XP_041419827.1" /db_xref="GeneID:379132" /db_xref="Xenbase:XB-GENE-951614" /translation="
MANAGLQLLGFALACLGWIGFIVCIAIPQWKMSSFAGDAIITAQITYEGLWMSCVMQSTGQMQCKSFDSLLKLDSTIQATRALMICGILVGFFAMCIAAVGMKCLTCLQDDEVKKAKVGVVGGALFIVAGLCVLIATAWYGDKIAKDFYNMFTPTNSKYEFGPALFIGWAGAALAIIGGALLCCSCPRKETSYPPPRGYNKSAPPAGKDYV"
misc_feature 203..736 /gene="cldn1.S" /gene_synonym="claudin-1; cld1; cldn1; ilvasc; semp1" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:473919" ORIGIN
ataagcagaagttttcatttaggaaatagacttggcagaccactgatcaactctttcttctctacttttttcttacttgggaagttttcagtctacatttacctaagagtcctccttaaacttcagcagaacagacaaggcctgcttcagagtgaggccaagttgtaacttactttatccactccaaaggatggccaacgcaggcttgcaacttttaggattcgccttagcttgtctgggctggattgggtttatagtatgtattgcaatccctcaatggaaaatgtcatcatttgctggggatgccattatcacagcacagataacctatgaaggactctggatgtcttgtgtaatgcagagcacagggcagatgcagtgcaaatcttttgactcattgctgaagctggacagtactatacaggccacccgagcattgatgatctgtggaattcttgttggtttctttgccatgtgcattgctgcagtagggatgaaatgcttgacatgtcttcaggatgatgaagtaaagaaggcaaaggttggagtagtgggaggagcactcttcattgttgctggtctctgtgttttgatagcaacagcttggtatggagataaaatcgcaaaggatttttacaatatgttcacaccaaccaattctaaatatgagtttggccctgccttatttattggatgggctggagctgcgctagcaatcattggaggtgctttgctctgttgctcttgtcccagaaaagagacttcctacccaccaccaagaggctacaataaaagtgcaccacctgctggaaaagattatgtgtaacaaaggaaatactgtatgcaactaccatggggacattaggacattattctccacttatttcattaatgttaaaggcattgcattgccttagattcagcaacagtaccatgctgtcatgttattcagcaacccagtatagcaatgacagtgataagttaatgcaggaagatattaaaatcttaaaagtcaacaatatgaattagaaaacagaaggttgtgcagatgtcagctttaatctatgtcatattattgtcttcacaaaacccacaccctaatcctataaagcttgcctaattatatacaaatactgtatatatatatatatatatatatatatatatatatatatatatatatatatatatatatatatatatatatatatataccatacttcatatcagcttcatatataactagcaacagcaatcatggttctttttcccttttgttttggtacaatataaattgcaagaattggttatattctgtgttatttctgtataaatctattttttttgttttgtatatgactgttattttcaataagcaatagtaatgaattctgtttcaaggcagaactgaatccaagcatggggtacaatgtacagacatggtttcaggcaattttttgtcagttttgtggattacttccattatgtgatttttttaataaataagacttttacaagaaaa
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]