2024-04-26 06:59:29, GGRNA.v2 : RefSeq release 222 (Jan, 2024)
LOCUS XM_041430549 360 bp mRNA linear PLN 15-SEP-2021 DEFINITION Suillus discolor ABC transporter (F5147DRAFT_558639), partial mRNA. ACCESSION XM_041430549 VERSION XM_041430549.1 DBLINK BioProject: PRJNA727289 BioSample: SAMN12812516 KEYWORDS RefSeq. SOURCE Suillus discolor ORGANISM Suillus discolor Eukaryota; Fungi; Dikarya; Basidiomycota; Agaricomycotina; Agaricomycetes; Agaricomycetidae; Boletales; Suillineae; Suillaceae; Suillus. REFERENCE 1 (bases 1 to 360) AUTHORS Lofgren,L.A., Nguyen,N.H., Vilgalys,R., Ruytinx,J., Liao,H.L., Branco,S., Kuo,A., LaButti,K., Lipzen,A., Andreopoulos,W., Pangilinan,J., Riley,R., Hundley,H., Na,H., Barry,K., Grigoriev,I.V., Stajich,J.E. and Kennedy,P.G. TITLE Comparative genomics reveals dynamic genome evolution in host specialist ectomycorrhizal fungi JOURNAL New Phytol (2020) In press PUBMED 33355923 REMARK Publication Status: Available-Online prior to print REFERENCE 2 (bases 1 to 360) CONSRTM NCBI Genome Project TITLE Direct Submission JOURNAL Submitted (15-SEP-2021) National Center for Biotechnology Information, NIH, Bethesda, MD 20894, USA REFERENCE 3 (bases 1 to 360) AUTHORS Kuo,A., Lofgren,L.A., Vilgalys,R., Nguyen,N.H., Ruytinx,J., Liao,H.-L., Branco,S., LaButti,K., Lipzen,A., Andreopoulos,W., Pangilinan,J., Riley,R., Hundley,H., Na,H., Grigoriev,I., Barry,K., Stajich,J.E. and Kennedy,P.G. CONSRTM DOE Joint Genome Institute TITLE Direct Submission JOURNAL Submitted (22-APR-2020) DOE Joint Genome Institute, 2800 Mitchell Drive, Walnut Creek, CA 94598-1698, USA COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. This record is derived from an annotated genomic sequence (NW_024541351). ##Metadata-START## Organism Display Name :: Suillus discolor FC423 v1.0 GOLD Stamp ID :: Gp0305074 ##Metadata-END## COMPLETENESS: incomplete on both ends. FEATURES Location/Qualifiers source 1..360 /organism="Suillus discolor" /mol_type="mRNA" /strain="FC423" /db_xref="taxon:1912936" /chromosome="Unknown" gene <1..>360 /locus_tag="F5147DRAFT_558639" /db_xref="GeneID:64692808" CDS <1..>360 /locus_tag="F5147DRAFT_558639" /codon_start=1 /product="ABC transporter" /protein_id="XP_041286207.1" /db_xref="GeneID:64692808" /db_xref="InterPro:IPR003439" /db_xref="JGIDB:Suidis1_558639" /translation="
IYVALVSSSGCSKSTVIQSLECFYDPISGQISLDGELIDEFNVQAYRQQLSLVSQEPNLYAGTIHFNILLGASIPESEVTQEEIEAACCDANILDFIQSLPDGFNTEVGGKGSQLLGGQK"
misc_feature 7..>360 /locus_tag="F5147DRAFT_558639" /note="P-loop containing Nucleoside Triphosphate Hydrolases; Region: P-loop_NTPase; cl38936" /db_xref="CDD:453896" misc_feature 19..42 /locus_tag="F5147DRAFT_558639" /note="Walker A/P-loop; other site" /db_xref="CDD:213179" misc_feature 154..165 /locus_tag="F5147DRAFT_558639" /note="Q-loop/lid; other site" /db_xref="CDD:213179" ORIGIN
atttatgttgccttagtcagctctagtggttgcagtaaaagtacagtcatccagtcactagagtgtttctacgatccaatttctggacagatttcactcgacggagagcttatcgacgagtttaacgtccaggcatatcgacagcagctttcacttgtgtcgcaagagcctaatttgtacgcgggaactatccacttcaatatcttgctcggtgcctccataccggaatctgaggtcacacaagaagagattgaggccgcttgttgtgatgctaatatactagattttattcaatcacttccagatggatttaatactgaagtcggtggcaagggatcccagcttttggggggtcaaaaa
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]