GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2026-06-13 13:20:09, GGRNA.v2 : RefSeq release 233 (Jan, 2026)

LOCUS       XM_039022647             686 bp    mRNA    linear   PLN 13-JAN-2021
DEFINITION  PREDICTED: Benincasa hispida signal peptidase complex subunit
            3B-like (LOC120070765), mRNA.
ACCESSION   XM_039022647
VERSION     XM_039022647.1
DBLINK      BioProject: PRJNA691418
KEYWORDS    RefSeq.
SOURCE      Benincasa hispida (wax gourd)
  ORGANISM  Benincasa hispida
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
            Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae;
            Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae;
            Benincaseae; Benincasa.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_052350.1) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Full annotation
            Annotation Name             :: Benincasa hispida Annotation Release
                                           100
            Annotation Version          :: 100
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 8.5
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..686
                     /organism="Benincasa hispida"
                     /mol_type="mRNA"
                     /cultivar="B227"
                     /db_xref="taxon:102211"
                     /chromosome="2"
                     /tissue_type="young leaf"
                     /dev_stage="seedlings with two fully expanded leaves"
                     /geo_loc_name="China: Guangdong"
     gene            1..686
                     /gene="LOC120070765"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 14 Proteins, and 100% coverage of
                     the annotated genomic feature by RNAseq alignments,
                     including 55 samples with support for all annotated
                     introns"
                     /db_xref="GeneID:120070765"
     CDS             1..504
                     /gene="LOC120070765"
                     /codon_start=1
                     /product="signal peptidase complex subunit 3B-like"
                     /protein_id="XP_038878575.1"
                     /db_xref="GeneID:120070765"
                     /translation="
MHSFGYRANALVTFAVTILVIMCAMASFSDNFNSPSPTASVQVLNINWFQKQLHGNDEVSMTLNISVDLQSLFTWNTKQVFVFVAAEYETPKNSLNQISLWDGIIPSKDNAKFTIHTSNKYRFIDQGSNLRGKEFNLTLHWHVMPKTGKMFADKIVMSGYRLPEDYR"
     misc_feature    1..492
                     /gene="LOC120070765"
                     /note="Signal peptidase subunit; Region: SPC22; pfam04573"
                     /db_xref="CDD:461357"
ORIGIN      
atgcattcttttggttatcgagccaatgctttggtcactttcgccgtcaccattctcgtaattatgtgcgccatggcctctttctccgataacttcaactctccctctcccaccgccagtgttcaggtgttgaacatcaactggtttcagaagcagcttcatggaaatgacgaggtcagcatgaccttaaatatctcggtggacttgcagtcactatttacatggaacacaaagcaggtttttgtttttgtagctgctgagtatgaaactcctaagaattccttgaaccagatctcgctttgggatggtataataccttccaaagataatgccaaatttacgattcacacttcaaacaagtaccgtttcatcgatcagggaagcaatctcagaggtaaagaattcaacttgacgctgcattggcatgtaatgccaaaaaccggtaaaatgttcgctgataagatagtgatgtctgggtatcgcttaccggaggactatcgatgaagatgccttgatatggtatttaaaaacttacttttccatatatgagaatacagaaaattcagttcagctgagttagaaatttacagacaggagaaaagttgcatgtatgaaacaaatagaaagtgagttttgcttggagtttttgattcattcttctctcatttgcattttctctctcccta
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]