GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2024-07-15 05:30:12, GGRNA.v2 : RefSeq release 224 (May, 2024)

LOCUS       XM_037780761            2793 bp    mRNA    linear   VRT 19-NOV-2020
DEFINITION  PREDICTED: Sebastes umbrosus C-type lectin domain family 4 member
            M-like (LOC119494692), transcript variant X1, mRNA.
ACCESSION   XM_037780761
VERSION     XM_037780761.1
DBLINK      BioProject: PRJNA675852
KEYWORDS    RefSeq.
SOURCE      Sebastes umbrosus (honeycomb rockfish)
  ORGANISM  Sebastes umbrosus
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Actinopterygii; Neopterygii; Teleostei; Neoteleostei;
            Acanthomorphata; Eupercaria; Perciformes; Scorpaenoidei;
            Sebastidae; Sebastinae; Sebastes.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_051277.1) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Full annotation
            Annotation Name             :: Sebastes umbrosus Annotation Release
                                           100
            Annotation Version          :: 100
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 8.5
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..2793
                     /organism="Sebastes umbrosus"
                     /mol_type="mRNA"
                     /isolate="fSebUmb1"
                     /db_xref="taxon:72105"
                     /chromosome="9"
                     /sex="male"
                     /tissue_type="muscle"
                     /dev_stage="adult"
                     /country="USA: California coast"
                     /lat_lon="33.599833 N 118.265167 W"
                     /collection_date="05-Oct-2017"
                     /collected_by="University of Washington"
     gene            1..2793
                     /gene="LOC119494692"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 3 Proteins, and 100% coverage of
                     the annotated genomic feature by RNAseq alignments,
                     including 9 samples with support for all annotated
                     introns"
                     /db_xref="GeneID:119494692"
     CDS             16..1494
                     /gene="LOC119494692"
                     /codon_start=1
                     /product="CD209 antigen-like isoform X1"
                     /protein_id="XP_037636689.1"
                     /db_xref="GeneID:119494692"
                     /translation="
MYSSLQREKDELQTNKDQQQTRYSSLQREKDELQTNKDQLQTRYSSLQREKDELQTNKDQLQTRYSSLQREKDELQTLSVTLRANRDQLQSNYSSLKTNKDQLQRSYNTLSISRNHIQTSYNSSQKDKERLQSSYNSLQKEKEQLQQSYSSLTTERDDFKTSSNNLKSERNQLQARYNTLKQESNQLQTNKDQLQTRYSSLQRQKDELQTNKDQLQTRYSSLQRQKDELQTNKDQLQTRYSSLQRQKDELQTNKDQLQTRYSSLQREKDTLQTLSVMLKANRDLLQRNYSSLKINKDQLQRSYNTLSLSKMSLQTRYNSLEKDKERLQSSYNTLQREKEQLQTKYTSLAAARDQLQKKIDKVRAKPCQTGWSKFDISCYFVSNLEKNWTQSRQYCIAEGADLVVIDSRDEQAFVNGLLDDGKNAWTGMTDSIIEGIWMWVDGTPVTTTYWGENQPNSYDGNQDCGETVQRSSGVGDWNDDGCFGDQNFICEK"
     misc_feature    37..>837
                     /gene="LOC119494692"
                     /note="chromosome segregation protein SMC, common
                     bacterial type; Region: SMC_prok_B; TIGR02168"
                     /db_xref="CDD:274008"
     misc_feature    <577..>1107
                     /gene="LOC119494692"
                     /note="Uncharacterized conserved protein, contains a
                     C-terminal ATPase domain [Function unknown]; Region:
                     COG4913"
                     /db_xref="CDD:443941"
     misc_feature    1114..1491
                     /gene="LOC119494692"
                     /note="C-type lectin-like domain (CTLD) of the type found
                     in human dendritic cell (DC)-specific intercellular
                     adhesion molecule 3-grabbing non-integrin (DC-SIGN) and
                     the related receptor, DC-SIGN receptor (DC-SIGNR); Region:
                     CLECT_DC-SIGN_like; cd03590"
                     /db_xref="CDD:153060"
     misc_feature    order(1282..1284,1375..1377,1381..1383,1399..1401,
                     1417..1422,1447..1458)
                     /gene="LOC119494692"
                     /note="carbohydrate binding site; other site"
                     /db_xref="CDD:153060"
     misc_feature    order(1303..1305,1315..1317,1384..1386,1399..1404)
                     /gene="LOC119494692"
                     /note="calcium binding site 1 [ion binding]; other site"
                     /db_xref="CDD:153060"
     misc_feature    order(1315..1317,1402..1404)
                     /gene="LOC119494692"
                     /note="calcium binding site 3 [ion binding]; other site"
                     /db_xref="CDD:153060"
ORIGIN      
gaccagcaacagaccatgtacagtagccttcaaagagaaaaagatgagttacagactaataaagaccagcaacagaccaggtacagtagccttcaaagagaaaaagatgagttacagactaataaagaccagctacagaccaggtacagtagcctgcaaagagaaaaagatgagttacagactaataaagaccagctacagaccaggtacagtagcctgcaaagagaaaaagatgagttacagactttgtctgttacgctgagagcaaacagagatcagttgcagagcaattactcttcactgaagacgaacaaggaccagttgcaaagaagctataacacactgagtataagtaggaatcacattcagaccagctacaattcatcgcagaaagacaaagaacgattgcagtccagttataattctctgcagaaggaaaaagaacagttacagcaaagttacagttctttgactaccgaaagagatgacttcaagaccagttccaacaatctaaaaagcgagaggaaccagttacaagcacgttacaacaccttaaaacaagagagcaatcagttacagactaataaagaccagctacagaccaggtacagtagcctgcaaagacaaaaagatgagctacagactaataaagaccagctacagaccaggtacagtagcctgcaaagacaaaaagatgagctacagactaataaagaccagctacagaccaggtacagtagcctgcaaagacaaaaagatgagctacagactaataaagaccagctacagaccaggtacagtagcctgcaaagagaaaaagatacattacagactttgtctgttatgctgaaagcaaacagagatctgttgcagagaaattactcttcactgaagataaacaaggaccagttgcaaagaagctataacacactgagtttaagtaagatgtcccttcagaccagatacaattcattggagaaagacaaagaacgattgcagtcgagctataatactctgcagagggaaaaagagcagttacagaccaaatacaccagtttggctgcagctagagatcagctacagaagaagatcgacaaagtgagagctaaaccctgtcagacaggctggagtaagttcgacatcagctgttactttgtttcaaatttggagaaaaactggacgcaaagccgacaatactgcatcgcagagggagcagatctagtcgtcatagacagcagggatgaacaggcatttgtcaacgggttactggatgacggcaaaaatgcctggactggtatgactgacagtattatagagggaatttggatgtgggtggacgggactccagtcaccactacgtactggggggagaaccagcccaacagctacgatgggaaccaggactgtggagaaactgtgcaaaggtcatcgggagttggagattggaacgatgacggctgttttggtgatcagaactttatctgtgagaaataatatcacaatgatttacacagttaatgatggtgtgttggactgcagttctaatgtacatcataactaattgattctttgtattaatccgcagctgaaaatagtccccaacaaatacagtgtttactccagtttgctaaaatctacaatgctccactgttttaggaaattactgagccttttttgaaaatgatggtatacatttatggctgtttttaaagattttcatcttcagtgggaactccatggactttcagaaagtgctgagagatggacgtacacattgggggatgttcttttcatgggatttgtagacaataacaaaagtatatgataatctcaggtttattctttgatactgttaaaggctgttttcagttaatctggctgattagacctcttctcaggactgtgtgggcgtgtatagactattgagtcacatcttcctgattctcctgttagctttgttgaacctgttaaggcgggataaattacacctttatcattcttattggtcgatgaagatttttgacctaataaatccccatcaaagctccggcccaccttcaacctgagcagaggtctaatcagacagaataactgaaatcacttgtgtgggtgttcagaggctttaaaggtcggttcacccaaattactatcgaacatatttctcatatttccacacctctagtggacatgtacgatatctatctctgagatttctgcctccagacagccaagtcttaatatattaaactttttaagctttaatgattttagacgagtacactttgatgcataacattgttaacatgttcataaatgtactatttagctgatgatttgtgtttgatgtaatggaatatgaatttcttggttgtacaaaaacgggttttactatgtgttaccgtgttctcttatgagtgtgctacatcagattcagcaaacactcctaacttcagataactgtgtaaatgcgtaaacatgatgaatgccacctgtgtgtaaataagcgctcgttcatgagaattgtaaattaacataattaacacaccaatgataccaagtatgaatctgtttgtacgagtggttcttgaggccaattgtctagtactctactatgatattctgtggcctttggcatagctttagaaatgtgtgcaaattgccatctgtttgattaatgaaattgtatgaaaatgaatgtataacacaaataatgtatgttacaaagcacatgcatacaacatttgcatatggttttaataatttactgtatcactctgtaatgattaaaaaata
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]