2024-04-27 08:58:11, GGRNA.v2 : RefSeq release 222 (Jan, 2024)
LOCUS XM_036812201 426 bp mRNA linear PLN 28-OCT-2020 DEFINITION Candida parapsilosis uncharacterized protein (CPAR2_704170), partial mRNA. ACCESSION XM_036812201 VERSION XM_036812201.1 DBLINK BioProject: PRJNA12179 KEYWORDS RefSeq. SOURCE Candida parapsilosis ORGANISM Candida parapsilosis Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina; Saccharomycetes; Saccharomycetales; Debaryomycetaceae; Candida/Lodderomyces clade; Candida. REFERENCE 1 (bases 1 to 426) AUTHORS Guida,A., Lindstaedt,C., Maguire,S.L., Ding,C., Higgins,D.G., Harris,D., Berriman,M. and Butler,G. TITLE Transcriptional landscape of the pathogenic yeast Candida parapsilosis JOURNAL Unpublished REFERENCE 2 (bases 1 to 426) CONSRTM NCBI Genome Project TITLE Direct Submission JOURNAL Submitted (26-OCT-2020) National Center for Biotechnology Information, NIH, Bethesda, MD 20894, USA REFERENCE 3 (bases 1 to 426) AUTHORS Guida,A. TITLE Direct Submission JOURNAL Submitted (19-OCT-2011) to the INSDC COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. This record is derived from an annotated genomic sequence (NW_023503284). COMPLETENESS: incomplete on both ends. FEATURES Location/Qualifiers source 1..426 /organism="Candida parapsilosis" /mol_type="mRNA" /strain="CDC317" /db_xref="taxon:5480" /chromosome="Unknown" gene <1..>426 /locus_tag="CPAR2_704170" /db_xref="GeneID:59386622" CDS 1..426 /locus_tag="CPAR2_704170" /note="Similar to C. albicans DFR1, Trimethoprim resistant dihydrofolate reductase (DHFR), reduces 7,8-dihydrofolate to 5,4,7,8-tetrahydrofolate" /codon_start=1 /transl_table=12 /product="uncharacterized protein" /protein_id="XP_036668562.1" /db_xref="GeneID:59386622" /translation="
MGRKTWDSIPTKFRPLPNRLNVVLSRSFDNKVIDENILHASSVEDSLKLVREENIERVYVIGGAEIYNEFIKSGLVDNVLLTEIEHSEQEEIAMDTFLKFDVNQWTKSSKSELIQFTGEEAIDDDNQENKFVYNYTLWQKR"
misc_feature <1..417 /locus_tag="CPAR2_704170" /note="Dihydrofolate reductase (DHFR). Reduces 7,8-dihydrofolate to 5,6,7,8-tetrahydrofolate with NADPH as a cofactor. This is an essential step in the biosynthesis of deoxythymidine phosphate since 5,6,7,8-tetrahydrofolate is required to regenerate 5; Region: DHFR; cd00209" /db_xref="CDD:238127" misc_feature order(7..15,76..78,184..195) /locus_tag="CPAR2_704170" /note="NADP+ binding site [chemical binding]; other site" /db_xref="CDD:238127" ORIGIN
atgggaagaaaaacctgggactcgataccgaccaagttcagacccttgcctaacagactcaatgttgtattgtctagatcgtttgacaataaagttatcgatgagaatattttgcatgcaagttcagttgaggactcattgaagcttgtacgagaagaaaatattgaacgtgtttatgtcattggtggtgctgaaatttacaacgagtttatcaagagtggattagttgataatgtcttgttgactgaaatagaacattcggagcaagaagagattgcaatggatacgtttttgaaatttgatgtgaaccaatggacaaaactgtcgaaatcggaattgattcaattcacaggagaggaagcaatcgatgacgacaaccaagaaaacaagtttgtttacaattacacattatggcaaaaacggtag
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]