LOCUS       XM_036676707             333 bp    mRNA    linear   PLN 29-DEC-2023
DEFINITION  Fusarium subglutinans uncharacterized protein (FSUBG_11968),
            partial mRNA.
ACCESSION   XM_036676707
VERSION     XM_036676707.1
DBLINK      BioProject: PRJNA670753
            BioSample: SAMN13683616
KEYWORDS    RefSeq.
SOURCE      Fusarium subglutinans
  ORGANISM  Fusarium subglutinans
            Eukaryota; Fungi; Dikarya; Ascomycota; Pezizomycotina;
            Sordariomycetes; Hypocreomycetidae; Hypocreales; Nectriaceae;
            Fusarium; Fusarium fujikuroi species complex.
REFERENCE   1  (bases 1 to 333)
  AUTHORS   Kim,H.S., Lohmar,J.M., Busman,M., Brown,D.W., Naumann,T.A.,
            Divon,H.H., Lysoe,E., Uhlig,S. and Proctor,R.H.
  TITLE     Correction to: Identification and distribution of gene clusters
            required for synthesis of sphingolipid metabolism inhibitors in
            diverse species of the filamentous fungus Fusarium
  JOURNAL   BMC Genomics 21 (1), 712 (2020)
   PUBMED   33059601
  REMARK    Correction to:[BMC Genomics. 2020 Jul 23;21(1):510. PMID: 32703172]
            Publication Status: Online-Only
REFERENCE   2  (bases 1 to 333)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (28-DEC-2023) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 333)
  AUTHORS   Kim,H.-S., Proctor,R.H. and Brown,D.W.
  TITLE     Direct Submission
  JOURNAL   Submitted (01-MAY-2020) Mycotoxin Prevention and Applied
            Microbiology Research Unit, USDA, ARS, NCAUR, 1815 N University St,
            Peoria, IL 61604, USA
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. This record is derived from an annotated genomic
            sequence (NW_023502305).
            COMPLETENESS: incomplete on both ends.
FEATURES             Location/Qualifiers
     source          1..333
                     /organism="Fusarium subglutinans"
                     /mol_type="mRNA"
                     /strain="NRRL 66333"
                     /isolation_source="Plant"
                     /host="Zea mays"
                     /culture_collection="NRRL:66333"
                     /db_xref="taxon:42677"
                     /chromosome="Unknown"
                     /country="USA: New Mexico"
     gene            <1..>333
                     /locus_tag="FSUBG_11968"
                     /db_xref="GeneID:59311425"
     CDS             1..333
                     /locus_tag="FSUBG_11968"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_036532576.1"
                     /db_xref="GeneID:59311425"
                     /translation="

MFHLNASAVRSGMAMFILSMDGMFWAPMVVLTLGIPYYVASGGPIPTPGKEAKVPGVEGTYAAIIDNPESPMEVYKMMPRGKLSIIVAVPPNGSEVSMTSTEIPWSVFKA"

ORIGIN      

atgtttcacctcaacgcttccgccgtgagatccgggatggccatgttcatcttgtcaatggacgggatgttctgggccccgatggtggttctaactcttggaataccctattacgtggcaagcggcggcccaataccaacgccagggaaggaagccaaagtgcctggtgtcgaaggaacctacgccgctatcatcgacaatccggagagccccatggaagtctacaagatgatgccgcgcggtaaacttagtatcatcgttgctgtgcccccgaacgggtcagaggtcagcatgacctctaccgaaatcccatggtctgtcttcaaggcgtaa

//