GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2024-03-29 16:16:43, GGRNA.v2 : RefSeq release 222 (Jan, 2024)

LOCUS       XM_036168105             426 bp    mRNA    linear   ROD 23-SEP-2020
DEFINITION  PREDICTED: Onychomys torridus cysteine-rich secretory protein
            1-like (LOC118569849), mRNA.
ACCESSION   XM_036168105
VERSION     XM_036168105.1
DBLINK      BioProject: PRJNA664182
KEYWORDS    RefSeq; includes ab initio.
SOURCE      Onychomys torridus (southern grasshopper mouse)
  ORGANISM  Onychomys torridus
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha;
            Muroidea; Cricetidae; Neotominae; Onychomys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_050460.1) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Full annotation
            Annotation Name             :: Onychomys torridus Annotation
                                           Release 100
            Annotation Version          :: 100
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 8.5
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
            
            ##RefSeq-Attributes-START##
            ab initio :: 15% of CDS bases
            ##RefSeq-Attributes-END##
FEATURES             Location/Qualifiers
     source          1..426
                     /organism="Onychomys torridus"
                     /mol_type="mRNA"
                     /db_xref="taxon:38674"
                     /chromosome="18"
     gene            1..426
                     /gene="LOC118569849"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 1 Protein"
                     /db_xref="GeneID:118569849"
     CDS             1..426
                     /gene="LOC118569849"
                     /codon_start=1
                     /product="cysteine-rich secretory protein 1-like"
                     /protein_id="XP_036023998.1"
                     /db_xref="GeneID:118569849"
                     /translation="
MILFPLLLFLAAVLPPSVLREYYENMEIEHLKTTRESVQEEIVKKHNQLRRMVYPPGSDLLKMQWSNDARVNAQRWANQCTYEDSPEDSRTTNIKCGENIFVSEYPVSWSCAIQSWYDESIDLRFGSNPFPAGYTQFRITL"
     misc_feature    109..>408
                     /gene="LOC118569849"
                     /note="CAP (cysteine-rich secretory proteins, antigen 5,
                     and pathogenesis-related 1 proteins) domain family;
                     Region: CAP; cl00133"
                     /db_xref="CDD:412178"
ORIGIN      
atgatattattcccactgttgttgtttcttgctgctgtgttacccccatccgttcttcgagaatactatgagaatatggaaatcgagcatttgaaaaccactagagagtcagtccaagaagagattgtaaagaagcacaaccaactgagaagaatggtttatccacctggtagtgacttactaaagatgcaatggagcaatgatgcccgagtgaatgcacagagatgggcaaaccagtgcacttacgaagacagtcctgaagattccaggaccaccaacataaaatgtggtgagaatatcttcgtttcagagtacccagtatcatggtcttgtgcaattcaaagctggtatgatgaatccatagatttaaggtttggttcaaacccatttccagctggttatactcagttccgaatcaccctatga
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]