GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2020-11-27 00:02:58, GGRNA.v2 : RefSeq release 202 (Sep, 2020)

LOCUS       XM_034308249             574 bp    mRNA    linear   VRT 13-MAY-2020
DEFINITION  PREDICTED: Pangasianodon hypophthalmus NRDE-2, necessary for RNA
            interference, domain containing (nrde2), mRNA.
ACCESSION   XM_034308249
VERSION     XM_034308249.1
DBLINK      BioProject: PRJNA630732
KEYWORDS    RefSeq; includes ab initio.
SOURCE      Pangasianodon hypophthalmus (striped catfish)
  ORGANISM  Pangasianodon hypophthalmus
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Actinopterygii; Neopterygii; Teleostei; Ostariophysi; Siluriformes;
            Pangasiidae; Pangasianodon.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_047604.1) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Full annotation
            Annotation Name             :: Pangasianodon hypophthalmus
                                           Annotation Release 101
            Annotation Version          :: 101
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 8.4
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
            
            ##RefSeq-Attributes-START##
            ab initio :: 19% of CDS bases
            ##RefSeq-Attributes-END##
FEATURES             Location/Qualifiers
     source          1..574
                     /organism="Pangasianodon hypophthalmus"
                     /mol_type="mRNA"
                     /strain="Indonesia"
                     /db_xref="taxon:310915"
                     /chromosome="10"
                     /sex="male"
                     /tissue_type="blood"
                     /dev_stage="adult"
                     /collection_date="Oct-2017"
                     /collected_by="Remi Dugue, Institut de recherche pour le
                     developpement, Institut des Sciences de l'Evolution de
                     Montpellier, Universite de Montpellier, 34095 Montpellier
                     cedex 5, France"
     gene            1..574
                     /gene="nrde2"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 83% coverage of the annotated
                     genomic feature by RNAseq alignments, including 11 samples
                     with support for all annotated introns"
                     /db_xref="GeneID:117598321"
     CDS             89..574
                     /gene="nrde2"
                     /codon_start=1
                     /product="uncharacterized protein nrde2"
                     /protein_id="XP_034164140.1"
                     /db_xref="GeneID:117598321"
                     /translation="
MALFPAFGGVSDADNSKNTDQEWLSNLSFSSVDALSLHQRTIHRDAAETHTPCHTHSSEQKPDEDDDEDHTRSKKRRKKEKKTKRKKQKKRSRDDLENSDSDTVYPSDLLNRELEPSQRCENYSQTMRTKGTQGTKRTENNHWRRTSEPTGKPVPCREKNQ"
ORIGIN      
gaaaattatccgcttctgacgtcatatgtgtgcgacagtgcttggatagcaggttagctagcaggttttaggcaggtttagctgcattatggcgttatttcctgcatttggaggagtgtcagatgctgataactctaaaaacacagatcaagaatggctcagtaatctcagtttcagcagcgtggatgctttgtctctacaccaacgcaccatccacagagacgcagcggagacacacactccatgccacacacacagcagtgagcagaagcctgatgaagatgatgatgaagatcacaccagatcaaagaagaggagaaagaaagagaagaagacgaagaggaaaaagcagaagaagcgcagcagagacgatttggagaacagcgactcggacacggtttaccccagtgaccttctgaaccgagaactggaaccatcacagaggtgtgagaactattcacagactatgagaactaaggggactcagggaactaaaagaactgaaaacaaccactggaggagaaccagtgagccaaccgggaaaccagtgccatgtagagagaagaaccaatga
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]