2024-04-20 21:47:07, GGRNA.v2 : RefSeq release 222 (Jan, 2024)
LOCUS XM_034156758 300 bp mRNA linear PLN 06-MAY-2020 DEFINITION Diutina rugosa uncharacterized protein (DIURU_003940), partial mRNA. ACCESSION XM_034156758 VERSION XM_034156758.1 DBLINK BioProject: PRJNA629604 BioSample: SAMN11490865 KEYWORDS RefSeq. SOURCE Diutina rugosa ORGANISM Diutina rugosa Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina; Saccharomycetes; Saccharomycetales; Saccharomycetales incertae sedis; Diutina. REFERENCE 1 (bases 1 to 300) AUTHORS Mixao,V., Saus,E., Hansen,A., Lass-Flor,C. and Gabaldon,T. TITLE Genome assembly of two rare yeast pathogens: Diutina rugosa and Trichomonascus ciferrii JOURNAL Unpublished REFERENCE 2 (bases 1 to 300) CONSRTM NCBI Genome Project TITLE Direct Submission JOURNAL Submitted (06-MAY-2020) National Center for Biotechnology Information, NIH, Bethesda, MD 20894, USA REFERENCE 3 (bases 1 to 300) AUTHORS Mixao,V., Saus,E., Hansen,A., Lass-Flor,C. and Gabaldon,T. TITLE Direct Submission JOURNAL Submitted (10-JUL-2019) Bioinformatics, Centre for Genomic Regulation, Carrer Dr. Aiguader, 88, 5, Barcelona 08003, Spain COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. This record is derived from an annotated genomic sequence (NW_022995166). COMPLETENESS: incomplete on both ends. FEATURES Location/Qualifiers source 1..300 /organism="Diutina rugosa" /mol_type="mRNA" /strain="CBS 613" /isolation_source="feces" /host="Homo sapiens" /culture_collection="CBS:613" /type_material="type material of Mycoderma rugosum" /db_xref="taxon:5481" /chromosome="Unknown" /country="USA" gene <1..>300 /locus_tag="DIURU_003940" /db_xref="GeneID:54782591" CDS 1..300 /locus_tag="DIURU_003940" /codon_start=1 /transl_table=12 /product="uncharacterized protein" /protein_id="XP_034011263.1" /db_xref="GeneID:54782591" /translation="
MAKSGIAVGLNKGHKTTAKEVAPKISYRKGALTKRTEFVRSIVSEVAGLAPYERRLIELIRNAGEKRAKKLAKKRLGTHKRALKKVEEMNGVIAASRKH"
misc_feature 10..294 /locus_tag="DIURU_003940" /note="Ribosomal protein L36e; Region: Ribosomal_L36e; pfam01158" /db_xref="CDD:426088" ORIGIN
atggctaagtctggtattgctgttggtctcaacaagggtcacaagactaccgctaaggaagtcgcccccaagatctcgtacagaaagggtgccctcaccaagagaaccgagttcgtcagatcgatcgtgtcggaagtcgccgggttggctccttacgaaagaagattgatcgaattgatcagaaacgccggtgaaaagagagccaagaagttggccaagaagagattgggtacccacaagagagccttgaagaaggttgaagagatgaacggtgtcatcgctgcttccagaaagcactaa
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]