LOCUS       XM_033645988            2323 bp    mRNA    linear   VRT 20-APR-2020
DEFINITION  PREDICTED: Epinephelus lanceolatus SEC14-like lipid binding 7
            (sec14l7), transcript variant X2, mRNA.
ACCESSION   XM_033645988
VERSION     XM_033645988.1
DBLINK      BioProject: PRJNA625542
KEYWORDS    RefSeq.
SOURCE      Epinephelus lanceolatus (giant grouper)
  ORGANISM  Epinephelus lanceolatus
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Actinopterygii; Neopterygii; Teleostei; Neoteleostei;
            Acanthomorphata; Eupercaria; Perciformes; Serranoidei; Serranidae;
            Epinephelinae; Epinephelini; Epinephelus.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_047007.1) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Full annotation
            Annotation Name             :: Epinephelus lanceolatus Annotation
                                           Release 100
            Annotation Version          :: 100
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 8.4
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..2323
                     /organism="Epinephelus lanceolatus"
                     /mol_type="mRNA"
                     /isolate="Andai001"
                     /db_xref="taxon:310571"
                     /chromosome="17"
                     /sex="female"
                     /tissue_type="blood and muscle"
     gene            1..2323
                     /gene="sec14l7"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 11 Proteins, and 100% coverage of
                     the annotated genomic feature by RNAseq alignments,
                     including 1 sample with support for all annotated introns"
                     /db_xref="GeneID:117269166"
     CDS             140..1192
                     /gene="sec14l7"
                     /codon_start=1
                     /product="SEC14-like protein 2 isoform X2"
                     /protein_id="XP_033501879.1"
                     /db_xref="GeneID:117269166"
                     /translation="

MIRKHLEFRKKMNIDSIISDWKPPEVIDKYVSGGMCGYDREGSPIWYDVIGPLDPKGLLLSATKQDFMKTKIRHTEMLQRECQRQSEKLGQNVEAITLIYDCEGLGLKHIWKPAIETYGEILTMFEDNYPEGLKRVFLIKAPRMFPMAYNLIKHFLCEETRRKIIVLGSNWQEVLRKHIDPEQLPVVYGGTLTDPDGDPRCRTMIKYGGTVPKSYYVQDSVKVQYDSSVTISRGSVLQLEYDVTAASSLLRWQFASDGADIGFGVYRRTKEGVGQKVAEMLQVLPSERYNAHLVPEDSGLTCSEPGVYVLCFDNSYSILQSKRVSYKVEVLPPPDGQMQSPRSRGDGRLQ"

     misc_feature    206..715
                     /gene="sec14l7"
                     /note="Domain in homologues of a S. cerevisiae
                     phosphatidylinositol transfer protein (Sec14p); Region:
                     SEC14; smart00516"
                     /db_xref="CDD:214706"
     misc_feature    order(269..271,275..277,281..283,371..373,437..439,
                     443..445,491..493,503..505,515..517,527..529,536..538,
                     545..547,551..553,572..574,593..595,629..631)
                     /gene="sec14l7"
                     /note="phospholipid binding pocket [chemical binding];
                     other site"
                     /db_xref="CDD:238099"
     misc_feature    order(530..532,626..628)
                     /gene="sec14l7"
                     /note="salt bridge; other site"
                     /db_xref="CDD:238099"
     misc_feature    830..1123
                     /gene="sec14l7"
                     /note="Golgi-dynamics membrane-trafficking; Region:
                     GOLD_2; pfam13897"
                     /db_xref="CDD:433565"
ORIGIN      

tgcgttcactgcacttagatacacttctgagtttcgggggaggatccaggacatcctccccaacctgcctgcacagcacgaccactacctcctccgctggctccgagctcgtagcttcaatgttcagaaagctgaaactatgatcagaaagcatctggagttcaggaagaagatgaacattgactccatcatatctgactggaaacctccagaggtgattgacaagtacgtgtctggagggatgtgtggatacgacagggagggcagtcccatctggtatgatgtcatcggccctctggaccctaaaggtctgttgctatcggcaaccaaacaagacttcatgaagacgaagatcagacacactgagatgctgcagagggagtgtcagaggcagtcggagaagttggggcagaacgttgaagcgatcactctgatctatgactgtgaaggactcggactgaaacacatctggaaacctgccatagagacgtatggagagatcctcaccatgtttgaagacaactatccagagggcctgaagagggtgtttctgatcaaagctccgagaatgtttcccatggcctacaacctcatcaaacacttcctgtgtgaggagacacgacggaagatcatcgttttaggaagtaactggcaggaagtgttacgtaaacacatcgaccccgagcagcttcctgtggtgtacggaggaaccctgactgatcctgatggagaccctcgctgcagaaccatgataaagtacggcggcacagttcccaagtcgtactacgttcaggactcggtgaaggttcagtacgacagcagcgtgaccatcagccgaggctccgtcctccagctagaatatgatgtcacagcagccagcagcctcctgaggtggcagtttgccagcgacggagcggacatcgggttcggagtgtacagacggaccaaagagggcgtcggacagaaagtggctgagatgctgcaggttctgcccagcgaacgctacaatgcacacctggtccctgaagacagcggcctcacctgctctgagcctggagtctacgtgctgtgtttcgataacagctacagcatcctgcagtccaagagggtgagctacaaagtcgaggttcttcctccgccggacggacagatgcagagtccacgcagccgaggagacggcaggctgcagtgagcgggagcacagagttcactgagtatcaccagtcactgacagcaaaatcaatacacttacatcagggcaaaaaacaactgtggacttcctgtcaacacctctgtttgtcccactgtacgcatcatatatgtgttagtttataatcagtaattatccctcaataacttgtttatagagcagtcttttacaatgcagctgataaccacttgtgccctacctgcagacacaggctgatgaacgtagtgaagcatttagcatctaaatgtttccctcaaaagttcctgtattgttattgtaacaagatcgactacagctgctttaaatacaaattattagccgcagcaccggtgatagctgtggacgaagcattatgttttcaggttttccatctgtccatccatccttgtgatatctcaaggaacggctcaagggaatttcttcaaatttcccacaaatgtccacttggactcagcaatgaactgatacgtttttggtggtcataggtcaaagatcaaggtcactgtgaccttgtctgtttcatttctccaaaacacctcaaggaaatttcattgaaaatttgacacaaatgtccactttgactgaaaaataaactgatgagaattaggtggtcaaaggtaaaaggtcaaggtcactgtgaccttcctttctcattcttgtgcaaaaagtatctcattaacacctaatgggaattttttcaaatttggaacaaatgttcacttggactctatgaacaggttagagttgatggtcaaaggtcaaggttactgtgaccttgcatctgtctcattcttgtgaatgtgatatctcaagagcactataaggacatttctttacatttggcacaaacgtccactgtagaataatctggctagaagtttgtggtcaaaggtcaagatctgtgtgactttgcatctgtctcattcttgtgaatgcgctatcttaataacttgaggggatttcttcaaatttggcacaaatgttcactaggactcaaccataatctgattggatttcagtggtcaaaggtcagaggtcaaggtcactgtgaccttgcttctgtctcattcttgaaatgcgatatctcaaaaacaccttgagggaatttcttca

//