GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2024-07-15 05:06:47, GGRNA.v2 : RefSeq release 224 (May, 2024)

LOCUS       XM_033393191            1954 bp    mRNA    linear   INV 14-APR-2020
DEFINITION  PREDICTED: Drosophila miranda trichohyalin-like (LOC108161194),
            mRNA.
ACCESSION   XM_033393191
VERSION     XM_033393191.1
DBLINK      BioProject: PRJNA623594
KEYWORDS    RefSeq.
SOURCE      Drosophila miranda
  ORGANISM  Drosophila miranda
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_046677.1) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Full annotation
            Annotation Name             :: Drosophila miranda Annotation
                                           Release 102
            Annotation Version          :: 102
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 8.4
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1954
                     /organism="Drosophila miranda"
                     /mol_type="mRNA"
                     /strain="MSH22"
                     /db_xref="taxon:7229"
                     /chromosome="4"
                     /sex="male"
                     /tissue_type="Whole body"
     gene            1..1954
                     /gene="LOC108161194"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 100% coverage of the annotated
                     genomic feature by RNAseq alignments, including 21 samples
                     with support for all annotated introns"
                     /db_xref="GeneID:108161194"
     CDS             58..1794
                     /gene="LOC108161194"
                     /codon_start=1
                     /product="trichohyalin-like"
                     /protein_id="XP_033249082.1"
                     /db_xref="GeneID:108161194"
                     /translation="
MLNIFIIVLVFFNLSENLTRGSDFHENQESCFVSRELEDQCAAVCYPTVKPLLKYMGICHQKDLQISGMQNQLQDQNEEVTKYKTQVEILNKQLVDKRSSSGLKNDLKETIDKVQNLRLELSEELKKLYRQKNNTVKDLHEEIANVKMQLKSKDELLEQNEKTMIEKDELLKQKEKNMEEKDELLKKKEKNMEEKDGLLKKKDSTLKNLQEEIANVKMQLTRKDELLKENEKTMTEKDELLKQKEKNMEEKDEILKHKDSPMKDLHEEIANVKIQLTRKDELLDQKEKTMIEKDELLKQMEKNMEEKDEMLKQKEKKMEENDELLKQKEKNMEEKDEMLKQKEKNMEEKDEMLKQKEKKMEENDELLKQKEKNRDEKDELLKKKDSTMKDLHEEIANVKIQLRSKDEFLEQKEQKKEQFIRPILDNADPKTSETHTIDVPLKEPDESGWTIILQELEGLASLEKKLAQYKEKPFNNGNDSFFIGRKNLYFMTLATPHEILIQVKFVDGRSSSVQDIRFKMGNAKKDYTLRSVNDNLPNRKYSITEMKALIAIQVLMKRKMPFSSRDWKQLTIKFREIQ"
     misc_feature    <391..1284
                     /gene="LOC108161194"
                     /note="chromosome segregation protein SMC, common
                     bacterial type; Region: SMC_prok_B; TIGR02168"
                     /db_xref="CDD:274008"
     misc_feature    1345..>1647
                     /gene="LOC108161194"
                     /note="Fibrinogen-related domains (FReDs); C terminal
                     globular domain of fibrinogen. Fibrinogen is involved in
                     blood clotting, being activated by thrombin to assemble
                     into fibrin clots. The N-termini of 2 times 3 chains come
                     together to form a globular...; Region: FReD; cl00085"
                     /db_xref="CDD:412152"
     misc_feature    1639..1641
                     /gene="LOC108161194"
                     /note="gamma-gamma dimer interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:238040"
ORIGIN      
gcgaattcagttggtattctgttgtgttcgagaaatatcaaggtatattcccagaatatgttgaatatttttattattgtgttggttttctttaatttgtcggagaatttgacacgtggttcagatttccatgaaaaccaagagtcgtgttttgtatcaagagaactggaagatcaatgcgctgccgtttgttatcccaccgtcaagccgttgcttaaatacatgggaatatgccatcagaaggatctacaaataagtggaatgcagaaccaacttcaagaccaaaatgaggaggttaccaaatacaaaactcaagtagaaattctcaataaacagttggtagataagcgaagttcttctggcctcaagaatgacctaaaagaaaccatcgataaggtgcagaacctcagattggagctcagtgaagagttgaaaaagttatacagacagaaaaacaataccgtgaaggatctgcacgaagaaatcgcgaatgtgaaaatgcagctgaagagcaaggatgaacttttagaacaaaacgagaaaacaatgatagaaaaggatgaactattaaaacaaaaggagaaaaatatggaagaaaaggatgaactattaaaaaagaaggagaaaaatatggaagaaaaggatggactactaaaaaagaaggatagtaccttgaagaatctgcaagaagaaatcgcgaatgtgaagatgcaactgacgagaaaggatgaacttttaaaagaaaacgagaaaacaatgacagaaaaggatgaactattaaaacaaaaggagaaaaatatggaagaaaaggatgaaatattaaaacataaggatagtcccatgaaggatctgcacgaagaaatcgcgaatgtgaagatacaactgacgagaaaggatgaacttttagaccaaaaggagaaaacaatgatagaaaaggatgaactattaaaacagatggagaaaaatatggaagaaaaggatgaaatgttaaaacaaaaagagaaaaagatggaagaaaacgatgaactattaaaacagaaggagaaaaatatggaagaaaaggatgaaatgttaaaacaaaaggagaaaaatatggaagaaaaggatgaaatgttaaaacaaaaggagaaaaagatggaagaaaacgatgaactattaaaacagaaggagaaaaatagggatgaaaaggatgaactattaaaaaagaaggatagtaccatgaaggatctgcacgaagaaatcgcgaatgtgaagatacaactgaggagcaaggatgaatttttagagcaaaaggagcaaaaaaaggagcagtttattaggccaattttggataatgcagacccaaaaaccagcgagactcatacaatcgatgttcctttgaaagaaccagacgaaagtggttggacaattattttgcaagaacttgagggattggctagtctagaaaagaagctagctcaatataaagaaaagccgttcaacaatggaaatgattcatttttcatcggccgcaagaatctgtatttcatgacactggccacgccacacgaaattcttatccaagtgaaatttgtggatggcagaagttcttcggttcaagacattcgcttcaaaatgggcaacgcaaaaaaagactacacactgaggtcggtcaatgataatttaccaaacagaaagtactccattaccgaaatgaaagcgcttatagcgattcaggttcttatgaaacgaaaaatgccattcagttctagggactggaagcaattgaccattaagttcagagagatccaataatagaagaagaaaccattatgcgcccttgatagagaagtatttttatgtatttaaatacatttttaaattcttcggtaatcgatgatgctaccgtgaactaacgtaaaaaaaaatagtttaaaaaataaaagttaatgctggtttttctgttattttctaa
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]