GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2024-04-25 00:22:52, GGRNA.v2 : RefSeq release 222 (Jan, 2024)

LOCUS       XM_033361334             742 bp    mRNA    linear   INV 23-FEB-2022
DEFINITION  PREDICTED: Belonocnema kinseyi uncharacterized LOC117172993
            (LOC117172993), transcript variant X2, mRNA.
ACCESSION   XM_033361334
VERSION     XM_033361334.1
DBLINK      BioProject: PRJNA623416
KEYWORDS    RefSeq.
SOURCE      Belonocnema kinseyi
  ORGANISM  Belonocnema kinseyi
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Hymenoptera; Apocrita;
            Proctotrupomorpha; Cynipoidea; Cynipidae; Cynipinae; Cynipini;
            Belonocnema.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_046661.1) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Updated annotation
            Annotation Name             :: Belonocnema kinseyi Updated
                                           Annotation Release 100.20220217
            Annotation Version          :: 100.20220217
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 9.0
            Annotation Method           :: Best-placed RefSeq; propagated
                                           RefSeq model
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..742
                     /organism="Belonocnema kinseyi"
                     /mol_type="mRNA"
                     /isolate="2016_QV_RU_SX_M_011"
                     /host="Quercus virginiana"
                     /db_xref="taxon:2817044"
                     /chromosome="5"
                     /sex="male"
                     /tissue_type="whole body"
                     /dev_stage="Sexual adult"
                     /country="USA: Houston"
                     /collection_date="2017"
     gene            1..742
                     /gene="LOC117172993"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 100% coverage of the annotated
                     genomic feature by RNAseq alignments, including 2 samples
                     with support for all annotated introns"
                     /db_xref="GeneID:117172993"
     CDS             349..666
                     /gene="LOC117172993"
                     /codon_start=1
                     /product="uncharacterized protein LOC117172993"
                     /protein_id="XP_033217225.1"
                     /db_xref="GeneID:117172993"
                     /translation="
MSTGAGMGGGIGGGTGGGYGAPASTTATKAAAPKKDEDIITTMKHKVTESTMYRHVRHPIDHLGCKHHLKKKGCRVHKKRPPRAPMGGGMEGGMAGGGMMAGGMG"
ORIGIN      
gcggcggttaacgcgtcaaggattatccgtcctcggtagctttgcttgagaattgagagggttaacctgcccgaaggatttcttcaatctcttcttgttcagtttaaatttttatttttttccgaactgctacacagtaacgagggccaggaaagtaatcgagcaaggcaatgagatttgtagaggagaaaaactggaacggtgtccactcttcggaattaagaaccgactgaaatggactaaaagaaaaagaataacagacacagacgacatgcgacgtgccggtttgaaaataagcacgtggtgactgatgtaggtgcacaagagttgggaacgacggcgacaggtatgagcacgggtgctggtatgggtggtggtattgggggtggtacagggggaggctatggagctcctgcatctactaccgcaactaaagccgcagctcccaaaaaggatgaggatatcattactacgatgaaacataaagtgacagaaagcactatgtacagacatgtacgccacccaattgaccatcttggatgcaaacatcaccttaaaaagaagggttgtcgagtacataaaaagagacctcctcgcgcccctatgggtggtggtatggaaggtggtatggcgggtggtggtatgatggctggtggtatgggttgaggtatgatttaataacatacttttcagaaattatgtaatatttctgtgaataagaacccaatccgcaaattaaaaa
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]