2025-09-19 01:32:10, GGRNA.v2 : RefSeq release 231 (Jul, 2025)
LOCUS XM_033361333 617 bp mRNA linear INV 23-FEB-2022 DEFINITION PREDICTED: Belonocnema kinseyi uncharacterized LOC117172993 (LOC117172993), transcript variant X1, mRNA. ACCESSION XM_033361333 VERSION XM_033361333.1 DBLINK BioProject: PRJNA623416 KEYWORDS RefSeq. SOURCE Belonocnema kinseyi ORGANISM Belonocnema kinseyi Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Hymenoptera; Apocrita; Proctotrupomorpha; Cynipoidea; Cynipidae; Cynipinae; Cynipini; Belonocnema. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_046661.1) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI Annotation Status :: Updated annotation Annotation Name :: Belonocnema kinseyi Updated Annotation Release 100.20220217 Annotation Version :: 100.20220217 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 9.0 Annotation Method :: Best-placed RefSeq; propagated RefSeq model Features Annotated :: Gene; mRNA; CDS; ncRNA ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..617 /organism="Belonocnema kinseyi" /mol_type="mRNA" /isolate="2016_QV_RU_SX_M_011" /host="Quercus virginiana" /db_xref="taxon:2817044" /chromosome="5" /sex="male" /tissue_type="whole body" /dev_stage="Sexual adult" /geo_loc_name="USA: Houston" /collection_date="2017" gene 1..617 /gene="LOC117172993" /note="Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 100% coverage of the annotated genomic feature by RNAseq alignments, including 4 samples with support for all annotated introns" /db_xref="GeneID:117172993" CDS 224..541 /gene="LOC117172993" /codon_start=1 /product="uncharacterized protein LOC117172993" /protein_id="XP_033217224.1" /db_xref="GeneID:117172993" /translation="
MSTGAGMGGGIGGGTGGGYGAPASTTATKAAAPKKDEDIITTMKHKVTESTMYRHVRHPIDHLGCKHHLKKKGCRVHKKRPPRAPMGGGMEGGMAGGGMMAGGMG"
ORIGIN
gcggcggttaacgcgtcaaggattatccgtcctcggtagctttgcttgagaattgagagggttaacctgcccgaaggatttcttcaatctcttcttgttcagtttaaatttttatttttttccgaactgctacacagtaacgagggccaggaaagtaatcgagcaaggcaatgagatttgtagagatgtaggtgcacaagagttgggaacgacggcgacaggtatgagcacgggtgctggtatgggtggtggtattgggggtggtacagggggaggctatggagctcctgcatctactaccgcaactaaagccgcagctcccaaaaaggatgaggatatcattactacgatgaaacataaagtgacagaaagcactatgtacagacatgtacgccacccaattgaccatcttggatgcaaacatcaccttaaaaagaagggttgtcgagtacataaaaagagacctcctcgcgcccctatgggtggtggtatggaaggtggtatggcgggtggtggtatgatggctggtggtatgggttgaggtatgatttaataacatacttttcagaaattatgtaatatttctgtgaataagaacccaatccgcaaattaaaaa
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]